OLFM-L3 Antibody - Azide and BSA Free

Western Blot: OLFM-L3 Antibody [NBP3-05678] - Western blot analysis of extracts of various cell lines, using OLFM-L3 antibody (NBP3-05678) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

OLFM-L3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit OLFM-L3 Antibody - Azide and BSA Free (NBP3-05678) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of mouse OLFM-L3 (NP_694797.1). HQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OLFML3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for OLFM-L3 Antibody - Azide and BSA Free

• HNOEL-iso
• HNOEL-isoOLF44
• hOLF44
• OLF44
• olfactomedin-like 3
• olfactomedin-like protein 3
• OLFML3
• OLFM-L3

Background

Secreted scaffold protein that plays an essential role in dorsoventral patterning during early development.Stabilizes axial formation by restricting chordin (CHRD) activity on the dorsal side. Acts by facilitating theassociation between the tolloid proteases and their substrate chordin (CHRD), leading to enhance chordin (CHRD)degradation . May have matrix-related function involved in placental and embryonic development, or playa similar role in other physiological processes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: OLFML3