OLFM-L3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OLFM-L3 Antibody [NBP2-68601] - Staining of human cell line LHCN-M2 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OLFM-L3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OLFML3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for OLFM-L3 Antibody

  • HNOEL-iso
  • HNOEL-isoOLF44
  • hOLF44
  • OLF44
  • olfactomedin-like 3
  • olfactomedin-like protein 3
  • OLFML3
  • OLFM-L3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00118427-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-85533
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56443
Species: Hu, Mu, Rt
Applications: WB
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
NBP1-88837
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Cz
Applications: WB, ELISA, IHC, IHC-P
H00006496-M04
Species: Hu
Applications: WB, ELISA
NBP1-98270
Species: Hu, Mu, Rt, Po, Ca, Eq, GP, Rb
Applications: WB
H00030062-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-29454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-31617
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82512
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-68601
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for OLFM-L3 Antibody (NBP2-68601) (0)

There are no publications for OLFM-L3 Antibody (NBP2-68601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLFM-L3 Antibody (NBP2-68601) (0)

There are no reviews for OLFM-L3 Antibody (NBP2-68601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OLFM-L3 Antibody (NBP2-68601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OLFM-L3 Products

Bioinformatics Tool for OLFM-L3 Antibody (NBP2-68601)

Discover related pathways, diseases and genes to OLFM-L3 Antibody (NBP2-68601). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OLFM-L3 Antibody (NBP2-68601)

Discover more about diseases related to OLFM-L3 Antibody (NBP2-68601).
 

Pathways for OLFM-L3 Antibody (NBP2-68601)

View related products by pathway.

Blogs on OLFM-L3

There are no specific blogs for OLFM-L3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OLFM-L3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OLFML3