OLFM-L3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: OLFM-L3 Antibody [NBP2-68601] - Staining of human cell line LHCN-M2 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OLFM-L3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAEKEREALRTEADTISGRVDRLEREVDYLETQNPALPCVEFDEKVTGGPGTKGKGRRNE
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OLFML3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
OLFM-L3 Recombinant Protein Antigen (NBP2-68601PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for OLFM-L3 Antibody

  • HNOEL-iso
  • HNOEL-isoOLF44
  • hOLF44
  • OLF44
  • olfactomedin-like 3
  • olfactomedin-like protein 3
  • OLFML3
  • OLFM-L3

Background

Secreted scaffold protein that plays an essential role in dorsoventral patterning during early development.Stabilizes axial formation by restricting chordin (CHRD) activity on the dorsal side. Acts by facilitating theassociation between the tolloid proteases and their substrate chordin (CHRD), leading to enhance chordin (CHRD)degradation . May have matrix-related function involved in placental and embryonic development, or playa similar role in other physiological processes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00118427-M06
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF2039
Species: Hu
Applications: IHC, Simple Western, WB
NB100-58824
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IP, WB
314-BP
Species: Hu
Applications: BA, BA
NBP1-88837
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP3-23662
Species: Hu
Applications: Flow, ICC/IF, IHC-P
H00006496-M04
Species: Hu
Applications: ELISA, WB
NBP1-80920
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56467
Species: Ca, Hu, Pm
Applications: WB
AF6480
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31617
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-68601
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for OLFM-L3 Antibody (NBP2-68601) (0)

There are no publications for OLFM-L3 Antibody (NBP2-68601).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OLFM-L3 Antibody (NBP2-68601) (0)

There are no reviews for OLFM-L3 Antibody (NBP2-68601). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for OLFM-L3 Antibody (NBP2-68601) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OLFM-L3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OLFML3