Optimedin Antibody (3A2)

Images

 
Western Blot: Optimedin Antibody (3A2) [H00118427-M06] - Analysis of OLFM3 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Optimedin Antibody (3A2) [H00118427-M06] - Analysis of OLFM3 expression in PC-12 (Cat # L012V1).
Western Blot: Optimedin Antibody (3A2) [H00118427-M06] - Analysis of OLFM3 expression in NIH/3T3 (Cat # L018V1).
ELISA: Optimedin Antibody (3A2) [H00118427-M06] - Detection limit for recombinant GST tagged OLFM3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
3A2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Optimedin Antibody (3A2) Summary

Immunogen
OLFM3 (NP_477518, 108 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKIT
Specificity
OLFM3 - olfactomedin 3
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
OLFM3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Optimedin Antibody (3A2)

  • NOE3OPTIMEDIN
  • noelin 3
  • NOELIN3
  • noelin-3
  • NOELIN3_V1
  • NOELIN3_V2
  • NOELIN3_V3
  • NOELIN3_V4
  • NOELIN3_V5
  • NOELIN3_V6
  • olfactomedin 3
  • olfactomedin related ER localized protein 3
  • olfactomedin-3
  • Optimedin

Background

Optimedin, also known as olfactomedin 3 (OLFM3) and Noelin-3, is a protein expressed in the eyes, brain, and lungs. The protein is known to stimulate the formation of cell adherent and cell-cell tight junctions. Additionally, its expression modulates cell migration and the organization of the cytoskeleton. In one study, cells expressing high levels of optimedin showed higher growth rates and stronger adhesion to the collagen extracellular matrix as compared with control cells. Optimedin has also been identified as a candidate gene for glaucoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB3446
Species: Hu
Applications: WB
AF5614
Species: Hu
Applications: WB
AF4636
Species: Mu
Applications: WB
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
NBP1-47610
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP2-67327
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
NBP2-31371
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7324
Species: Mu
Applications: WB
NBP1-49872
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-16686
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
H00342035-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
256-GF/CF
Species: Hu
Applications: BA
NBP2-49118
Species: Hu
Applications: IHC, IHC-P

Publications for Optimedin Antibody (H00118427-M06) (0)

There are no publications for Optimedin Antibody (H00118427-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Optimedin Antibody (H00118427-M06) (0)

There are no reviews for Optimedin Antibody (H00118427-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Optimedin Antibody (H00118427-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Optimedin Products

Bioinformatics Tool for Optimedin Antibody (H00118427-M06)

Discover related pathways, diseases and genes to Optimedin Antibody (H00118427-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Optimedin Antibody (H00118427-M06)

Discover more about diseases related to Optimedin Antibody (H00118427-M06).
 

Pathways for Optimedin Antibody (H00118427-M06)

View related products by pathway.

Research Areas for Optimedin Antibody (H00118427-M06)

Find related products by research area.

Blogs on Optimedin

There are no specific blogs for Optimedin, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Optimedin Antibody (3A2) and receive a gift card or discount.

Bioinformatics

Gene Symbol OLFM3
Entrez
OMIM
Uniprot