Optimedin Antibody (3A2) Summary
Immunogen |
OLFM3 (NP_477518, 108 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FRQIEDDRKTLMTKHFQELKEKMDELLPLIPVLEQYKTDAKLITQFKEEIRNLSAVLTGIQEEIGAYDYEELHQRVLSLETRLRDCMKKLTCGKLMKIT |
Specificity |
OLFM3 - olfactomedin 3 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
OLFM3 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Optimedin Antibody (3A2)
Background
Optimedin, also known as olfactomedin 3 (OLFM3) and Noelin-3, is a protein expressed in the eyes, brain, and lungs. The protein is known to stimulate the formation of cell adherent and cell-cell tight junctions. Additionally, its expression modulates cell migration and the organization of the cytoskeleton. In one study, cells expressing high levels of optimedin showed higher growth rates and stronger adhesion to the collagen extracellular matrix as compared with control cells. Optimedin has also been identified as a candidate gene for glaucoma.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: WB
Species: Hu
Applications: WB
Species: Mu
Applications: WB
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Publications for Optimedin Antibody (H00118427-M06) (0)
There are no publications for Optimedin Antibody (H00118427-M06).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Optimedin Antibody (H00118427-M06) (0)
There are no reviews for Optimedin Antibody (H00118427-M06).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Optimedin Antibody (H00118427-M06) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Optimedin Products
Bioinformatics Tool for Optimedin Antibody (H00118427-M06)
Discover related pathways, diseases and genes to Optimedin Antibody (H00118427-M06). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Optimedin Antibody (H00118427-M06)
Discover more about diseases related to Optimedin Antibody (H00118427-M06).
| | Pathways for Optimedin Antibody (H00118427-M06)
View related products by pathway.
|
Research Areas for Optimedin Antibody (H00118427-M06)
Find related products by research area.
|
Blogs on Optimedin