OGFOD1 Antibody

Images

 
Western Blot: OGFOD1 Antibody [NBP1-83826] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: OGFOD1 Antibody [NBP1-83826] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: OGFOD1 Antibody [NBP1-83826] - Staining of human cerebellum shows strong nuclear immunoreactivity in Purkinje cells and moderate positivity in granular cell layer.
Western Blot: OGFOD1 Antibody [NBP1-83826] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human Cerebral Cortex tissue
Western Blot: OGFOD1 Antibody [NBP1-83826] - Analysis in human cell line SK-BR-3.
Immunohistochemistry-Paraffin: OGFOD1 Antibody [NBP1-83826] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.
Immunohistochemistry: OGFOD1 Antibody [NBP1-83826] - Staining of mouse midbrain shows immunoreactivity in neuronal soma and nuclei of the ventral tegmental area.
Immunohistochemistry: OGFOD1 Antibody [NBP1-83826] - Staining of mouse hippocampus shows positivity in the CA3 area neurons.
Immunohistochemistry: OGFOD1 Antibody [NBP1-83826] - Staining of mouse cerebellum shows moderate labelling of Purkinje cells.
Immunohistochemistry-Paraffin: OGFOD1 Antibody [NBP1-83826] - Staining of human cerebral cortex shows moderate nuclear and cytoplasmic immunoreactivity in neuronal cell bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OGFOD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSF
Specificity
Specificity of human OGFOD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OGFOD1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. ICC/IF and IHC reported in the literature (PMID: 25929288).
Control Peptide
Publications
Read Publications using
NBP1-83826 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19351664)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for OGFOD1 Antibody

  • 2-oxoglutarate and iron-dependent oxygenase domain containing 1,2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1
  • EC 1.14.11
  • FLJ10826
  • KIAA1612TPA1, termination and polyadenylation 1, homolog
  • Termination and polyadenylation 1 homolog
  • TPA1EC 1.14.11.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66126
Species: Hu
H00000677-M02
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-83404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-56484
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP1-31113
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
AF5059
Species: Hu
Applications: WB, IHC
NBP1-89355
Species: Hu, Mu
Applications: WB, IHC, IHC-P
E-325
Species: Hu
NBP1-56969
Species: Hu, Mu, Rt, Bv, Ca, GP, Rb
Applications: WB
NBP1-88195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-76907
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-13509
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB110-74569
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC, IF

Publications for OGFOD1 Antibody (NBP1-83826)(4)

Reviews for OGFOD1 Antibody (NBP1-83826) (0)

There are no reviews for OGFOD1 Antibody (NBP1-83826). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for OGFOD1 Antibody (NBP1-83826) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OGFOD1 Products

Bioinformatics Tool for OGFOD1 Antibody (NBP1-83826)

Discover related pathways, diseases and genes to OGFOD1 Antibody (NBP1-83826). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OGFOD1 Antibody (NBP1-83826)

Discover more about diseases related to OGFOD1 Antibody (NBP1-83826).
 

Pathways for OGFOD1 Antibody (NBP1-83826)

View related products by pathway.

PTMs for OGFOD1 Antibody (NBP1-83826)

Learn more about PTMs related to OGFOD1 Antibody (NBP1-83826).
 

Research Areas for OGFOD1 Antibody (NBP1-83826)

Find related products by research area.

Blogs on OGFOD1

There are no specific blogs for OGFOD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OGFOD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OGFOD1