OGFOD1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: OGFOD1 Antibody [NBP1-83826] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: OGFOD1 Antibody [NBP1-83826] - Staining of human skin shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: OGFOD1 Antibody [NBP1-83826] - Staining of human skeletal muscle shows moderate to strong nuclear positivity in myocytes.

Staining of human cerebellum shows strong nuclear positivity in Purkinje cells.

Immunofluorescence staining of mouse brain shows strong nuclear and cytoplasmic positivity in neurons.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line SK-BR-3.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OGFOD1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EPENNQMAISNNSQQSNEQTDPEPEENETKKESSVPMCQGELRHWKTGHYTLIHDHSKAEFALDLILYCGCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHINHRSLEQKKTFPNRTGFWDFSF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OGFOD1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OGFOD1 Protein (NBP1-83826PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OGFOD1 Antibody - BSA Free

• 2-oxoglutarate and iron-dependent oxygenase domain containing 1,2-oxoglutarate and iron-dependent oxygenase domain-containing protein 1
• EC 1.14.11
• FLJ10826
• KIAA1612TPA1, termination and polyadenylation 1, homolog
• Termination and polyadenylation 1 homolog
• TPA1EC 1.14.11.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for OGFOD1 Antibody (NBP1-83826)(4)

Publications using NBP1-83826

• Kim JH, Lee SM, Lee JH et al. OGFOD1 is required for breast cancer cell proliferation and is associated with poor prognosis in breast cancer. Oncotarget 2015-08-14 [PMID: 25909288] (IF/IHC, ICC/IF, Human)
• Loenarz C, Sekirnik R, Thalhammer A et al. Hydroxylation of the eukaryotic ribosomal decoding center affects translational accuracy. Proc Natl Acad Sci U S A 2014-03-18 [PMID: 24550462]
• Wehner KA, Schutz S, Sarnow P. OGFOD1, a novel modulator of eukaryotic translation initiation factor 2 alpha phosphorylation and the cellular response to stress. Mol Cell Biol 2010-04-01 [PMID: 20154146]
• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Bioinformatics

• Gene Symbol: OGFOD1