OCA2 Antibody

Images

 
Western Blot: OCA2 Antibody [NBP1-60052] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

OCA2 Antibody Summary

Immunogen
Synthetic peptides corresponding to OCA2(oculocutaneous albinism II) The peptide sequence was selected from the middle region of OCA2. Peptide sequence LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (93%), Rabbit (100%), Bovine (100%), Guinea Pig (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
OCA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against OCA2 and was validated on Western blot.
Theoretical MW
93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for OCA2 Antibody

  • BEY
  • BEY1
  • BEY2
  • D15S12BOCA
  • EYCL
  • EYCL2
  • eye color 2 (central brown)
  • eye color 3 (brown)
  • hair color 3 (brown)
  • HCL3
  • Melanocyte-specific transporter protein
  • oculocutaneous albinism II (pink-eye dilution (murine) homolog)
  • oculocutaneous albinism II (pink-eye dilution homolog, mouse)
  • oculocutaneous albinism II
  • P protein
  • PED
  • PEYCL3
  • Pink-eyed dilution protein homolog
  • SHEP1
  • total brown iris pigmentation

Background

OCA2 is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in the gene encoding OCA2 result in type 2 oculocutaneous albinism.This gene encodes the human homologue of the mouse p (pink-eyed dilution) gene. The encoded protein is believed to be an integral membrane protein involved in small molecule transport, specifically tyrosine - a precursor of melanin. Mutations in this gene result in type 2 oculocutaneous albinism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67233
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88370
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5588
Species: Hu, Mu
Applications: WB, IHC
NBP1-59786
Species: Hu
Applications: WB
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NLS1040
Species: Hu, Pm
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-05970
Species: Hu, Mu
Applications: WB, IP
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for OCA2 Antibody (NBP1-60052) (0)

There are no publications for OCA2 Antibody (NBP1-60052).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OCA2 Antibody (NBP1-60052) (0)

There are no reviews for OCA2 Antibody (NBP1-60052). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OCA2 Antibody (NBP1-60052) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional OCA2 Products

Bioinformatics Tool for OCA2 Antibody (NBP1-60052)

Discover related pathways, diseases and genes to OCA2 Antibody (NBP1-60052). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OCA2 Antibody (NBP1-60052)

Discover more about diseases related to OCA2 Antibody (NBP1-60052).
 

Pathways for OCA2 Antibody (NBP1-60052)

View related products by pathway.

PTMs for OCA2 Antibody (NBP1-60052)

Learn more about PTMs related to OCA2 Antibody (NBP1-60052).

Blogs on OCA2

There are no specific blogs for OCA2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our OCA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol OCA2
Uniprot