Recombinant Human OATP1B1/OATP2 Protein

Images

 
SDS-Page: Recombinant Human OATP1B1/OATP2 Protein [H00010599-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human OATP1B1/OATP2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 481-570 of Human SLCO1B1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YISPCLAGCKSSSGNKKPIVFYNCSCLEVTGLQNRNYSAHLGECPRDDACTRKFYFFVAIQVLNLFFSALGGTSHVMLIVKIVQPELKSL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLCO1B1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human OATP1B1/OATP2 Protein

  • HBLRR
  • Liver-specific organic anion transporter 1
  • LST1
  • LST1SLC21A6
  • LST-1Solute carrier family 21 member 6
  • OATP1B1
  • OATP1B1Sodium-independent organic anion-transporting polypeptide 2
  • OATP2
  • OATP2MGC133282
  • OATPC
  • OATP-COATP-2
  • OATPCsolute carrier organic anion transporter family member 1B1
  • SLC01B1
  • SLC21A6
  • SLCO1B1
  • SO1B1
  • solute carrier family 21 (organic anion transporter), member 6
  • solute carrier organic anion transporter family, member 1B1

Background

SLCO1B1 - solute carrier organic anion transporter family, member 1B1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36492
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-56965
Species: Hu
Applications: WB, ICC/IF
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80977
Species: Hu
Applications: IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92393
Species: Hu
Applications: WB, IHC, IHC-P
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
AF6490
Species: Hu
Applications: WB, IHC, ICC
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP

Publications for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01) (0)

There are no publications for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01) (0)

There are no reviews for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional OATP1B1/OATP2 Products

Bioinformatics Tool for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01)

Discover related pathways, diseases and genes to OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01)

Discover more about diseases related to OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01).
 

Pathways for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01)

View related products by pathway.

PTMs for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01)

Learn more about PTMs related to OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01).
 

Research Areas for OATP1B1/OATP2 Partial Recombinant Protein (H00010599-Q01)

Find related products by research area.

Blogs on OATP1B1/OATP2

There are no specific blogs for OATP1B1/OATP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRP1 Antibody (IU2H10)
NB400-156-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human OATP1B1/OATP2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO1B1
Entrez