O-GlcNAcase/OGA/MGEA5 Antibody (1C7) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: O-GlcNAcase/OGA/MGEA5 Antibody (1C7) [H00010724-M02] - Analysis of monoclonal antibody to MGEA5 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: O-GlcNAcase/OGA/MGEA5 Antibody (1C7) [H00010724-M02] - Detection limit for recombinant GST tagged MGEA5 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 1C7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

O-GlcNAcase/OGA/MGEA5 Antibody (1C7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse O-GlcNAcase/OGA/MGEA5 Antibody (1C7) - Azide and BSA Free (H00010724-M02) is a monoclonal antibody validated for use in WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MGEA5 (NP_036347, 823 a.a. ~ 916 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SFHEEQEVLPETFLANFPSLIKMDIHKKVTDPSVAKSMMACLLSSLKANGSRGAFCEVRPDDKRILEFYSKLGCFEIAKMEGFPKDVVILGRSL
• Specificity: MGEA5 - meningioma expressed antigen 5 (hyaluronidase) (1C7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: OGA
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for O-GlcNAcase/OGA/MGEA5 Antibody (1C7) - Azide and BSA Free

• bifunctional protein NCOAT
• FLJ11229
• GH84
• HEXC
• HEXC3
• Hexosaminidase B
• hyaluronidase in meningioma
• KIAA0679
• MEA5FLJ23355
• meningioma expressed antigen 5 (hyaluronidase)
• Meningioma-expressed antigen 5
• MGEA5
• NCOAT
• Nuclear cytoplasmic O-GlcNAcase and acetyltransferase
• OGA
• OGlcNAcase
• O-GlcNAcase

Background

The dynamic modification of cytoplasmic and nuclear proteins by O-linked N-acetylglucosamine (O-GlcNAc) addition and removal on serine and threonine residues is catalyzed by OGT (MIM 300255), which adds O-GlcNAc, and MGEA5, a glycosidase that removes O-GlcNAc modifications (Gao et al., 2001 [PubMed 11148210]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OGA
• Entrez:
  • 10724(Human)
• Uniprot:
  • NP_036347(Human)