NUSAP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NUSAP1 Antibody [NBP2-13685] - Staining of human cell line U-2 OS shows localization to nucleus & nucleoli fibrillar center.
Immunohistochemistry-Paraffin: NUSAP1 Antibody [NBP2-13685] - Staining of human lymph node shows strong nuclear positivity in subsets of germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUSAP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLLKALKGYIKHEARKGNENQDESQTSASSCDETEIQISNQEEAERQPLG HVTKTRRRCKTVRVDPDSQQNHSEIKISNPTEFQNHEKQESQDFRATAKV PSPPDEHQEAENAVSSGNRDSKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUSAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
NUSAP1 Protein (NBP2-13685PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUSAP1 Antibody

  • ANKTNUSAP
  • BM037
  • FLJ13421
  • LNP
  • nucleolar and spindle associated protein 1
  • nucleolar and spindle-associated protein 1
  • nucleolar protein ANKT
  • NuSAP
  • NuSAP1
  • PRO0310p1
  • Q0310
  • SAPL

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19048
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-50509
Species: Hu
Applications: IHC, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-20454
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP2-14253
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80637
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB110-40573
Species: Hu
Applications: WB, IHC, IHC-P, IP
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB500-212
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-53281
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-P
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86878
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13685
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for NUSAP1 Antibody (NBP2-13685) (0)

There are no publications for NUSAP1 Antibody (NBP2-13685).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUSAP1 Antibody (NBP2-13685) (0)

There are no reviews for NUSAP1 Antibody (NBP2-13685). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NUSAP1 Antibody (NBP2-13685) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUSAP1 Products

Bioinformatics Tool for NUSAP1 Antibody (NBP2-13685)

Discover related pathways, diseases and genes to NUSAP1 Antibody (NBP2-13685). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUSAP1 Antibody (NBP2-13685)

Discover more about diseases related to NUSAP1 Antibody (NBP2-13685).
 

Pathways for NUSAP1 Antibody (NBP2-13685)

View related products by pathway.

Research Areas for NUSAP1 Antibody (NBP2-13685)

Find related products by research area.

Blogs on NUSAP1

There are no specific blogs for NUSAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUSAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUSAP1