NUP43 Antibody

Images

 
Western Blot: NUP43 Antibody [NBP1-88791] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88791] - Staining of human cerebral cortex shows cytoplasmic and nuclear positivity in neuronal cells and glial cells.
Immunohistochemistry-Paraffin: NUP43 Antibody [NBP1-88791] - Staining of human hippocampus shows strong nuclear membranous positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUP43 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FGMEEIYAKFVSQKISKTRWRPLPPGSLQTAETFATGSWDNEENYISLWSIGDFGNLDSDGGFEGDHQLLCDIRHHGDVMDLQF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUP43
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NUP43 Protein (NBP1-88791PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUP43 Antibody

  • bA350J20.1
  • FLJ13287
  • nucleoporin 43kDa
  • nucleoporin Nup43
  • Nup107-160 subcomplex subunit Nup43
  • p42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NBP1-82614
Species: Hu
Applications: IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUP43 Antibody (NBP1-88791) (0)

There are no publications for NUP43 Antibody (NBP1-88791).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUP43 Antibody (NBP1-88791) (0)

There are no reviews for NUP43 Antibody (NBP1-88791). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUP43 Antibody (NBP1-88791) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUP43 Products

Bioinformatics Tool for NUP43 Antibody (NBP1-88791)

Discover related pathways, diseases and genes to NUP43 Antibody (NBP1-88791). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for NUP43 Antibody (NBP1-88791)

View related products by pathway.

Blogs on NUP43

There are no specific blogs for NUP43, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUP43 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUP43