NUP133 Antibody (4F6) - Azide and BSA Free

Western Blot: NUP133 Antibody (4F6) [H00055746-M02] - NUP133 monoclonal antibody (M02), clone 4F6. Analysis of NUP133 expression in HeLa.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NUP133 Antibody (4F6) - Azide and BSA Free Summary

• Immunogen: NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
• Specificity: NUP133 - nucleoporin 133kDa (4F6)
• Isotype: IgG
• Clonality: Monoclonal
• Host: Mouse
• Gene: NUP133
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NUP133 Antibody (4F6) - Azide and BSA Free

• FLJ10814
• hNUP133,133 kDa nucleoporin
• MGC21133
• nuclear pore complex protein Nup133
• nucleoporin 133kD
• nucleoporin 133kDa
• Nucleoporin Nup133

Background

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUP133 Antibody (H00055746-M02)(1)

Publication using H00055746-M02

• Rossi A, Coum A, Madelenat M, et al. Neural stem cells alter nucleocytoplasmic partitioning and accumulate nuclear polyadenylated transcripts during quiescence bioRxiv 2021-01-07

Bioinformatics

• Gene Symbol: NUP133
• Entrez:
  • 55746(Human)
• Uniprot:
  • NP_060700(Human)