POMZP3 Antibody (2E7) - Azide and BSA Free

Western Blot: POMZP3 Antibody (2E7) [H00022932-M02] - POMZP3 monoclonal antibody (M02), clone 2E7. Analysis of POMZP3 expression in PC-12.

Immunohistochemistry-Paraffin: POMZP3 Antibody (2E7) [H00022932-M02] - Analysis of monoclonal antibody to POMZP3 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.

Western Blot: POMZP3 Antibody (2E7) [H00022932-M02] - POMZP3 monoclonal antibody (M02), clone 2E7 Analysis of POMZP3 expression in K-562.

Sandwich ELISA: POMZP3 Antibody (2E7) [H00022932-M02] - Detection limit for recombinant GST tagged POMZP3 is approximately 0.1ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, IHC
• Clone: 2E7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

POMZP3 Antibody (2E7) - Azide and BSA Free Summary

• Immunogen: POMZP3 (NP_694537, 64 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNM*
• Specificity: POMZP3 - POM (POM121 homolog, rat) and ZP3 fusion
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: POMZP3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for POMZP3 Antibody (2E7) - Azide and BSA Free

• MGC8359
• POM (POM121 rat homolog) and ZP3 fusion
• POM121 and ZP3 fusion protein
• POM121 and ZP3 fusion
• POM121/ZP3 fusion protein
• rat) and ZP3 fusion

Background

This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3' exons from the ZP3 gene. The 5' end of this gene is similar to the 5` coding region of the POM121 gene which encodes an integral nuclear pore membrane protein. However, the protein encoded by this gene lacks the nuclear pore localization motif. The 3' end of this gene is similar to the last 4 exons of the zona pellucida glycoprotein 3 (ZP3) gene and the encoded protein retains one zona pellucida domain. Multiple protein isoforms are encoded by transcript variants of this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: POMZP3
• Entrez:
  • 22932(Human)
• OMIM:
  • 600587(Human)
• Uniprot:
  • NP_694537(Human)