Recombinant Human Numb GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Numb Protein [H00008650-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE, AP

Order Details

Recombinant Human Numb GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-135 of Human NUMB full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MPYPAPNVPVVGITPSQMVANVFGTAGHPQAAHPHQSPSLVRQQTFPHYEASSATTSPFFKPPAQHLNGSAAFNGVDDGRLASADRHTEVPTGTCPVDPFEAQWAALENKSKQRTNPSPTNPFSSDLQKTFEIEL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
NUMB
Purity
>10% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
40.59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 2
using
H00008650-P01 in the following application:

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>10% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Numb GST (N-Term) Protein

  • h-Numb
  • mnb
  • m-numb
  • numb (Drosophila) homolog
  • numb homolog (Drosophila)
  • Numb
  • protein numb homolog
  • Protein S171
  • S171

Background

NUMB( AAH33824, 1 a.a. - 136 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-88136
Species: Hu
Applications: WB (-), IP
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
NBP1-80518
Species: Hu
Applications: WB
NBP1-88861
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90980
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31361
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-19997
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB200-103
Species: Hu, Mu, Rt, Ch, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-53125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NLS261
Species: Hu
Applications: WB (-), IHC, IHC-P, ICC
AF755
Species: Mu
Applications: WB, Block
H00008650-P01
Species: Hu
Applications: WB, ELISA, PA, PAGE, AP

Publications for Numb Recombinant Protein (H00008650-P01) (0)

There are no publications for Numb Recombinant Protein (H00008650-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Numb Recombinant Protein (H00008650-P01) (1) 21

Average Rating: 2
(Based on 1 review)

Reviews using H00008650-P01:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
  2
reviewed by:
Anonymous
02/25/2020
View

Summary

LotH6061
CommentsThe amino acid sequence of this recombinant protein matches residue 517-651 of human NUMB, not the 1 - 135 as it claimed.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Numb Recombinant Protein (H00008650-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Numb Products

Bioinformatics Tool for Numb Recombinant Protein (H00008650-P01)

Discover related pathways, diseases and genes to Numb Recombinant Protein (H00008650-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Numb Recombinant Protein (H00008650-P01)

Discover more about diseases related to Numb Recombinant Protein (H00008650-P01).
 

Pathways for Numb Recombinant Protein (H00008650-P01)

View related products by pathway.

PTMs for Numb Recombinant Protein (H00008650-P01)

Learn more about PTMs related to Numb Recombinant Protein (H00008650-P01).
 

Research Areas for Numb Recombinant Protein (H00008650-P01)

Find related products by research area.

Blogs on Numb

There are no specific blogs for Numb, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

2
5
0
4
0
3
0
2
1
1
0

 
Anonymous
02/25/2020
Application:
Species:

Bioinformatics

Gene Symbol NUMB