NUFIP1 Antibody

Images

 
Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Western Blot: NUFIP1 Antibody [NBP2-87965] - WB Suggested Anti-NUFIP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T
Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUFIP1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NUFIP1. Peptide sequence: GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NUFIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUFIP1 Antibody

  • bA540M5.1
  • nuclear fragile X mental retardation protein interacting protein 1
  • nuclear fragile X mental retardation protein-interacting protein 1
  • nuclear fragile X mental retardation-interacting protein 1
  • NUFIP
  • NUFIPNuclear FMRP-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01764
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32732
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20245
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-92269
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05509
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3499
Species: Hu
Applications: WB
NB300-259
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-97572
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vivo, KD, Simple Western, WB
NBP1-89546
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP1-81680
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-88683
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-87965
Species: Hu
Applications: WB

Publications for NUFIP1 Antibody (NBP2-87965) (0)

There are no publications for NUFIP1 Antibody (NBP2-87965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUFIP1 Antibody (NBP2-87965) (0)

There are no reviews for NUFIP1 Antibody (NBP2-87965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUFIP1 Antibody (NBP2-87965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUFIP1 Products

Bioinformatics Tool for NUFIP1 Antibody (NBP2-87965)

Discover related pathways, diseases and genes to NUFIP1 Antibody (NBP2-87965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUFIP1 Antibody (NBP2-87965)

Discover more about diseases related to NUFIP1 Antibody (NBP2-87965).
 

Pathways for NUFIP1 Antibody (NBP2-87965)

View related products by pathway.

PTMs for NUFIP1 Antibody (NBP2-87965)

Learn more about PTMs related to NUFIP1 Antibody (NBP2-87965).

Blogs on NUFIP1

There are no specific blogs for NUFIP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUFIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUFIP1