Home » NUFIP1 » NUFIP1 Antibodies » NUFIP1 Antibody

NUFIP1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml
Western Blot: NUFIP1 Antibody [NBP2-87965] - WB Suggested Anti-NUFIP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T
Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NUFIP1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NUFIP1. Peptide sequence: GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
NUFIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUFIP1 Antibody

  • bA540M5.1
  • nuclear fragile X mental retardation protein interacting protein 1
  • nuclear fragile X mental retardation protein-interacting protein 1
  • nuclear fragile X mental retardation-interacting protein 1
  • NUFIP
  • NUFIPNuclear FMRP-interacting protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

RUVBL2 Antibody
(OTI1A6)
NBP2-01764
Flow Cytometry: RUVBL2 Antibody (1A6) [NBP2-01764] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-RUVBL2 antibody, and then analyzed by flow cytometry.
Western Blot: RUVBL2 Antibody (1A6) [NBP2-01764] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RUVBL2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-RUVBL2.
Immunohistochemistry-Paraffin: RUVBL2 Antibody (1A6) [NBP2-01764] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-RUVBL2 mouse monoclonal antibody.
(1 Publication)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FMRP Antibody
(OTI1C6)
NBP2-01770
Flow Cytometry: FMRP Antibody (1C6) [NBP2-01770] - Analysis of Jurkat cells, using anti-FMRP antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Western Blot: FMRP Antibody (1C6) [NBP2-01770] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FMRP (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FMRP.
Immunohistochemistry-Paraffin: FMRP Antibody (1C6) [NBP2-01770] - Staining of paraffin-embedded Adenocarcinoma of Human breast tissue using anti-FMRP mouse monoclonal antibody.
(1 Review)
(2 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NHP2L1 Antibody
NBP1-32732
Western Blot: NHP2L1 Antibody [NBP1-32732] - A. 30 ug PC-12 whole cell lysate/extract B. 30 ug Rat2 whole cell lysate/extract15 % SDS-PAGE NHP2L1 antibody dilution: 1:1000
Immunocytochemistry/Immunofluorescence: NHP2L1 Antibody [NBP1-32732] - Paraformaldehyde-fixed HeLa, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: NHP2L1 Antibody [NBP1-32732] - Paraffin-embedded Cal27 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
RUVBL1 Antibody
NBP2-20245
Western Blot: RUVBL1 Antibody [NBP2-20245] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with RUVBL1 antibody diluted at 1:1000.
Western Blot: RUVBL1 Antibody [NBP2-20245] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with RUVBL1 antibody diluted at 1:2500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Immunohistochemistry-Paraffin: RUVBL1 Antibody [NBP2-20245] - Immunohistochemical analysis of paraffin-embedded Colon ca, using antibody at 1:500 dilution.
(2 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
PIH1D1 Antibody
NBP1-92269
Immunohistochemistry-Paraffin: PIH1D1 Antibody [NBP1-92269] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: PIH1D1 Antibody [NBP1-92269] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Western Blot: PIH1D1 Antibody [NBP1-92269] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Cyclin T1 Antibody
NBP3-05509
Immunocytochemistry/Immunofluorescence: Cyclin T1 Antibody [NBP3-05509] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in HeLa cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-CCNT1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Western Blot: Cyclin T1 Antibody [NBP3-05509] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
KLF6 Antibody
AF3499
KLF6 Antibody
(1 Publication)
Species: Hu
Applications: WB
FXR2 Antibody
(1G2) - BSA Free
NB300-259
Western Blot: FXR2 Antibody (1G2) [NB300-259] - Whole cell HeLa lysate at a concentration of 1:2500 (lane 1) and 1:500 (lane 2).
Immunocytochemistry/Immunofluorescence: FXR2 Antibody (1G2) [NB300-259] - FXR2 (1G2) antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
YB1 Antibody
NBP1-97572
Western Blot: YB1 Antibody [NBP1-97572] - Western blot analysis of YB1 expression in 1) HeLa and 2) NTera2 whole cell lysates using NBP1-97572.
Knockdown Validated: YB1 Antibody [NBP1-97572] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YB-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:10000 ug/ml of Rabbit Anti-Human YB-1 Polyclonal Antibody (Catalog # NBP1-97572) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for YB-1 at approximately 49 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: YB1 Antibody [NBP1-97572] - The YB1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin (NB100-690) were counterstained with DAPI (blue) and Dylight 550 (red).
(3 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vivo, KD, Simple Western, WB
FXR1 Antibody
NBP1-89546
Immunocytochemistry/Immunofluorescence: FXR1 Antibody [NBP1-89546] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: FXR1 Antibody [NBP1-89546] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
BRCA1 Antibody
(RAY) - BSA Free
NB100-598
Western Blot: BRCA1 Antibody (RAY) [NB100-598] - Analysis of BRCA1 on MCF7 lysate.
Immunocytochemistry/Immunofluorescence: BRCA1 Antibody (RAY) [NB100-598] - BRCA (RAY) antibody was tested in MCF-7 cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Flow Cytometry: BRCA1 Antibody (RAY) [NB100-598] - Intracellular flow cytometric staining of 1 x 10^6 MCF-7 cells using BRCA1 antibody (dark blue) and isotype control (orange). An antibody concentration of 1 ug/1x10^6 cells was used.
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NOP58 Antibody
NBP1-81680
Western Blot: NOP58 Antibody [NBP1-81680] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: NOP58 Antibody [NBP1-81680] - Analysis using Anti-NOP58 antibody NBP1-81680 (A) shows similar pattern to independent antibody NBP1-81681 (B).
Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81680] - Staining of human cerebral cortex shows strong nucleolar and weaker nuclear positivity in neurons.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(7 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Fibrillarin
Antibody (38F3)
NB300-269
Western Blot: Fibrillarin Antibody (38F3) [NB300-269] - Analysis of lysates of cell fractions probed with Fibrillarin antibody, dilution 1:500 (Green): [1] protein standard, [2] C6 cytosol, [3] C6 nuclear, [4] HEK293 cytosol, [5] HEK293 nuclear, [6] NIH-3T3 cytosol and [7] NIH-3T3 nuclear fractions. The band at 37kDa corresponds to the fibrillarin protein detected exclusively in the nuclear fractions.
Immunocytochemistry/Immunofluorescence: Fibrillarin Antibody (38F3) [NB300-269] - High magnification confocal image of HeLa cells stained with fibrillarin antibody, dilution 1:100 from concentrated tissue culture media (Green), and costained with chicken vimentin pAb (Red), dilution 1:1,000. Nuclear DNA is revealed with the DAPI stain (Blue). The fibrillarin antibody shows strong staining of nucleoli in the nucleus, while the vimentin antibody reveals cytoplasmic intermediate filaments.
Western Blot: Fibrillarin Antibody (38F3) [NB300-269] - Western blot analysis of Fibrillarin expression on yeast protein extracts using NB300-269.
(4 Reviews)
(20 Publications)
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Environmental novelty exacerbates stress hormones and Aβ pathology in an Alzheimer's model. Sci Rep (2017)
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(48 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
AAAS Antibody (5A1)
H00008086-M02
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - Western Blot analysis of AAAS expression in HeLa ( Cat # L013V1 ).
Immunohistochemistry-Paraffin: AAAS Antibody (5A1) [H00008086-M02] - Analysis of monoclonal antibody to AAAS on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml.
Western Blot: AAAS Antibody (5A1) [H00008086-M02] - AAAS monoclonal antibody (M02), clone 5A1. Analysis of AAAS expression in PC-12.
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
ZNHIT6 Antibody
NBP1-88683
Western Blot: ZNHIT6 Antibody [NBP1-88683] - Analysis in control (vector only transfected HEK293T lysate) and ZNHIT6 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: ZNHIT6 Antibody [NBP1-88683] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/Immunofluorescence: ZNHIT6 Antibody [NBP1-88683] - Staining of human cell line U-2 OS shows localization to nuclear speckles & vesicles.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NUFIP1 Antibody
NBP2-87965
NUFIP1 Antibody
Species: Hu
Applications: WB

Publications for NUFIP1 Antibody (NBP2-87965) (0)

There are no publications for NUFIP1 Antibody (NBP2-87965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUFIP1 Antibody (NBP2-87965) (0)

There are no reviews for NUFIP1 Antibody (NBP2-87965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NUFIP1 Antibody (NBP2-87965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUFIP1 Products

Bioinformatics Tool for NUFIP1 Antibody (NBP2-87965)

Discover related pathways, diseases and genes to NUFIP1 Antibody (NBP2-87965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUFIP1 Antibody (NBP2-87965)

Discover more about diseases related to NUFIP1 Antibody (NBP2-87965).
 

Pathways for NUFIP1 Antibody (NBP2-87965)

View related products by pathway.

PTMs for NUFIP1 Antibody (NBP2-87965)

Learn more about PTMs related to NUFIP1 Antibody (NBP2-87965).

Blogs on NUFIP1

There are no specific blogs for NUFIP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUFIP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NUFIP1