NUFIP1 Antibody - BSA Free

Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

Western Blot: NUFIP1 Antibody [NBP2-87965] - WB Suggested Anti-NUFIP1 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: Transfected 293T

Western Blot: NUFIP1 Antibody [NBP2-87965] - Host: Rabbit. Target Name: NUFIP1. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NUFIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUFIP1 Antibody - BSA Free (NBP2-87965) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NUFIP1. Peptide sequence: GQPWNFHASTSWYWRQSSDRFPRHQKSFNPAVKNSYYPRKYDAKFTDFSL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUFIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NUFIP1 Antibody - BSA Free

• bA540M5.1
• nuclear fragile X mental retardation protein interacting protein 1
• nuclear fragile X mental retardation protein-interacting protein 1
• nuclear fragile X mental retardation-interacting protein 1
• NUFIP
• NUFIPNuclear FMRP-interacting protein 1

Background

NUFIP1, also known as Nuclear fragile X mental retardation-interacting protein 1, is a 495 amino acid protein that is 56 kDa, binds RNA, contains a C2H2 zinc finger motif and a nuclear localization signal, it is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. Current research is being performed on several diseases and disorders including intellectual disability, neuronitis, microcephaly, and prostatitis. This protein has been shown to have interactions with YWHAZ, BRCA1, CCNT1, RUVBL2, FMR1, and over 30 other proteins in box C/D snoRNP assembly, RNA processing, and positive regulation of transcription from RNA polymerase II promoter pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUFIP1