NUFIP1 Antibody - Azide and BSA Free

Western Blot: NUFIP1 Antibody [H00026747-B02P] - Analysis of NUFIP1 expression in transfected 293T cell line by NUFIP1 polyclonal antibody. Lane 1: NUFIP1 transfected lysate(30.36 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: NUFIP1 Antibody [H00026747-B02P] - Analysis of purified antibody to NUFIP1 on HeLa cell. (antibody concentration 10 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NUFIP1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NUFIP1 Antibody - Azide and BSA Free (H00026747-B02P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NUFIP1 (AAH17745.1, 1 a.a. - 276 a.a.) full-length human protein. MHAPGMKKIKLDTPEEIARWREERRKNYPTLANIERKKKLKLEKEKRGAVLTTTQYGKMKGMSRHSQMAKIRSPGKNHKWKNDNSRQRAVTGSGSHLCDLKLEGPPEANADPLGVLINSDSESDKEEKPQHSVIPKEVTPALCSLMSSYGSLSGSESEPEETPIKTEADVLAENQVLDSSAPKSPSQDVKATVRNFSEAKSENRKKSFEKTNPKRKKDYHNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDFFGLDTNSAKSKDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: NUFIP1
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: This antibody is useful for Western Blot

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NUFIP1 Antibody - Azide and BSA Free

• bA540M5.1
• nuclear fragile X mental retardation protein interacting protein 1
• nuclear fragile X mental retardation protein-interacting protein 1
• nuclear fragile X mental retardation-interacting protein 1
• NUFIP
• NUFIPNuclear FMRP-interacting protein 1

Background

NUFIP1, also known as Nuclear fragile X mental retardation-interacting protein 1, is a 495 amino acid protein that is 56 kDa, binds RNA, contains a C2H2 zinc finger motif and a nuclear localization signal, it is associated with the nuclear matrix in perichromatin fibrils and, in neurons, localizes to the cytoplasm in association with endoplasmic reticulum ribosomes. Current research is being performed on several diseases and disorders including intellectual disability, neuronitis, microcephaly, and prostatitis. This protein has been shown to have interactions with YWHAZ, BRCA1, CCNT1, RUVBL2, FMR1, and over 30 other proteins in box C/D snoRNP assembly, RNA processing, and positive regulation of transcription from RNA polymerase II promoter pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUFIP1
• Uniprot:
  • AAH17745.1(Human)