NUDT2 Antibody - BSA Free

Western Blot: NUDT2 Antibody [NBP3-38345] - Western blot analysis of various lysates using NUDT2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDT2 Antibody - BSA Free (NBP3-38345) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human NUDT2 (NP_001152.1).
  
  Sequence:
  MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 17 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NUDT2 Antibody - BSA Free

• Ap4A hydrolase 1
• Ap4A hydrolase
• Ap4Aase
• APAH1Diadenosine 5'-5'''-P1
• bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
• bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
• diadenosine 5'-5''-P1
• Diadenosine tetraphosphatase
• EC 3.6.1.17
• MGC10404
• Nucleoside diphosphate-linked moiety X motif 2
• nudix (nucleoside diphosphate linked moiety X)-type motif 2
• Nudix motif 2
• P4-tetraphosphate asymmetrical hydrolase
• P4-tetraphosphate pyrophosphohydrolase

Background

NUDT2 encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDT2