NUDT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NUDT2 Antibody [NBP2-57066] - Staining of human cell line PC-3 shows localization to nucleus.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDT2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR
Specificity
Specificity of human NUDT2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUDT2 Recombinant Protein Antigen (NBP2-57066PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NUDT2 Antibody

  • Ap4A hydrolase 1
  • Ap4A hydrolase
  • Ap4Aase
  • APAH1Diadenosine 5'-5'''-P1
  • bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
  • bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
  • diadenosine 5'-5''-P1
  • Diadenosine tetraphosphatase
  • EC 3.6.1.17
  • MGC10404
  • Nucleoside diphosphate-linked moiety X motif 2
  • nudix (nucleoside diphosphate linked moiety X)-type motif 2
  • Nudix motif 2
  • P4-tetraphosphate asymmetrical hydrolase
  • P4-tetraphosphate pyrophosphohydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP1-89062
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
MAB7047
Species: Hu
Applications: WB, ICC
NBP1-90824
Species: Hu
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-92677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-86133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-69571
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-55046
Species: Hu
Applications: WB
NBP2-57066
Species: Hu, Rt
Applications: ICC/IF

Publications for NUDT2 Antibody (NBP2-57066) (0)

There are no publications for NUDT2 Antibody (NBP2-57066).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NUDT2 Antibody (NBP2-57066) (0)

There are no reviews for NUDT2 Antibody (NBP2-57066). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NUDT2 Antibody (NBP2-57066) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NUDT2 Products

Bioinformatics Tool for NUDT2 Antibody (NBP2-57066)

Discover related pathways, diseases and genes to NUDT2 Antibody (NBP2-57066). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDT2 Antibody (NBP2-57066)

Discover more about diseases related to NUDT2 Antibody (NBP2-57066).
 

Pathways for NUDT2 Antibody (NBP2-57066)

View related products by pathway.

Research Areas for NUDT2 Antibody (NBP2-57066)

Find related products by research area.

Blogs on NUDT2

There are no specific blogs for NUDT2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDT2