NUDT2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NUDT2 Antibody [NBP2-57066] - Staining of human cell line PC-3 shows localization to nucleus.

• Reactivity: Hu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUDT2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUDT2 Antibody - BSA Free (NBP2-57066) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALR
• Predicted Species: Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUDT2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NUDT2 Recombinant Protein Antigen (NBP2-57066PEP)

Reactivity Notes

Mouse 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NUDT2 Antibody - BSA Free

• Ap4A hydrolase 1
• Ap4A hydrolase
• Ap4Aase
• APAH1Diadenosine 5'-5'''-P1
• bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
• bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
• diadenosine 5'-5''-P1
• Diadenosine tetraphosphatase
• EC 3.6.1.17
• MGC10404
• Nucleoside diphosphate-linked moiety X motif 2
• nudix (nucleoside diphosphate linked moiety X)-type motif 2
• Nudix motif 2
• P4-tetraphosphate asymmetrical hydrolase
• P4-tetraphosphate pyrophosphohydrolase

Background

NUDT2 encodes a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. The gene product possesses a modification of the MutT sequence motif found in certain nucleotide pyrophosphatases. The enzyme asymmetrically hydrolyzes Ap4A to yield AMP and ATP and is responsible for maintaining the intracellular level of the dinucleotide Ap4A, the function of which has yet to be established. This gene may be a candidate tumor suppressor gene. Alternative splicing has been observed at this locus and three transcript variants, all encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NUDT2