NUDCD2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NUDCD2 Antibody [NBP1-84118] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & microtubules.
Immunohistochemistry-Paraffin: NUDCD2 Antibody [NBP1-84118] - Staining of human fallopian tube shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NUDCD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PFEERSGVVPCGTPWGQWYQTLEEVFIEVQVPPGTRAQDIQCGLQSRHVALSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NUDCD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NUDCD2 Protein (NBP1-84118PEP)
Publications
Read Publication using NBP1-84118.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NUDCD2 Antibody

  • DKFZp686E10109
  • NudC domain containing 2
  • nudC domain-containing protein 2
  • NudC-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
21400002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-07463
Species: Hu
NBP2-16287
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00009689-P01
Species: Hu
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00079921-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49387
Species: Hu
Applications: IHC, IHC-P
NB400-149
Species: Hu, Mu, Bv, Rt(-)
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3666
Species: Hu
Applications: WB, ICC
NBP2-32563
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86474
Species: Hu
Applications: IHC, IHC-P
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85846
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NUDCD2 Antibody (NBP1-84118)(1)

Reviews for NUDCD2 Antibody (NBP1-84118) (0)

There are no reviews for NUDCD2 Antibody (NBP1-84118). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NUDCD2 Antibody (NBP1-84118) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NUDCD2 Products

Bioinformatics Tool for NUDCD2 Antibody (NBP1-84118)

Discover related pathways, diseases and genes to NUDCD2 Antibody (NBP1-84118). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NUDCD2 Antibody (NBP1-84118)

Discover more about diseases related to NUDCD2 Antibody (NBP1-84118).
 

Pathways for NUDCD2 Antibody (NBP1-84118)

View related products by pathway.

Research Areas for NUDCD2 Antibody (NBP1-84118)

Find related products by research area.

Blogs on NUDCD2

There are no specific blogs for NUDCD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NUDCD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NUDCD2