DDHD2 Antibody

Images

 
Western Blot: DDHD2 Antibody [NBP1-82965] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: DDHD2 Antibody [NBP1-82965] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: DDHD2 Antibody [NBP1-82965] - Staining of human small intestine shows strong positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DDHD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RMHLELREGLTRMSMDLKNNLLGSLRMAWKSFTRAPYPALQASETPEETEAEPESTSEKPSDVNTEETSVAVKEEVLPINVGMLNGGQRIDYVLQEK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DDHD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DDHD2 Recombinant Protein Antigen (NBP1-82965PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DDHD2 Antibody

  • DDHD domain containing 2
  • DDHD domain-containing protein 2
  • EC 3.1.1.-
  • KIAA0725PA-PLA1 like
  • phospholipase DDHD2
  • SAM, WWE and DDHD domain containing 1
  • SAM, WWE and DDHD domain-containing protein 1
  • SAMWD1
  • sec23p-interacting protein p125-like phosphatidic acid-preferring phospholipaseA1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55527
Species: Hu
Applications: ICC/IF
NB100-56696
Species: Hu
Applications: WB, Flow
NBP1-04991
Species: Hu
Applications: ICC/IF (-), WB
NBP1-82456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14101
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-13903
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
H00079191-M05
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-16287
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00918
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-03891
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-49387
Species: Hu
Applications: IHC, IHC-P
NBP2-32563
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86474
Species: Hu
Applications: IHC, IHC-P
NBP1-92158
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DDHD2 Antibody (NBP1-82965) (0)

There are no publications for DDHD2 Antibody (NBP1-82965).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDHD2 Antibody (NBP1-82965) (0)

There are no reviews for DDHD2 Antibody (NBP1-82965). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DDHD2 Antibody (NBP1-82965) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DDHD2 Products

Bioinformatics Tool for DDHD2 Antibody (NBP1-82965)

Discover related pathways, diseases and genes to DDHD2 Antibody (NBP1-82965). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDHD2 Antibody (NBP1-82965)

Discover more about diseases related to DDHD2 Antibody (NBP1-82965).
 

Pathways for DDHD2 Antibody (NBP1-82965)

View related products by pathway.

Blogs on DDHD2

There are no specific blogs for DDHD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DDHD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDHD2