| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GZMK |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP2-49387 | Applications | Species |
|---|---|---|
| Christopher T, Matthew Z, Wendy B et al. Granzyme K contributes to endothelial microvascular damage and leakage during skin inflammation Br J Dermatol. 2022-10-23 [PMID: 36652225] (Immunohistochemistry-Paraffin, Human) | Immunohistochemistry-Paraffin | Human |
| Christopher T, Matthew Z, Katlyn R et al. Granzyme K Expressed by Classically Activated Macrophages Contributes to Inflammation and Impaired Remodeling J Invest Dermatol. 2018-11-03 [PMID: 30395844] (Immunohistochemistry-Paraffin, Human) | Immunohistochemistry-Paraffin | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC | Human | 06/16/2017 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Granzyme K Antibody (NBP2-49387)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GZMK |