Granzyme K Antibody

Images

 
Western Blot: Granzyme K Antibody [NBP2-49387] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining in human tonsil and cerebral cortex tissues using anti-GZMK antibody. Corresponding GZMK RNA-seq data are ...read more
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human tonsil shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Granzyme K Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS
Specificity
Specificity of human Granzyme K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GZMK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Granzyme K Recombinant Protein Antigen (NBP2-49387PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-49387 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Granzyme K Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.4
  • Fragmentin-3
  • Granzyme 3
  • granzyme K (granzyme 3; tryptase II)
  • granzyme K (serine protease, granzyme 3; tryptase II)
  • Granzyme K
  • Granzyme-3
  • Granzyme-K
  • GZMK
  • NK-Tryp-2
  • NK-Tryptase-2
  • PRSS
  • TRYP2
  • TRYP2granzyme-3
  • Tryptase II

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-26444
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-57614
Species: Hu
Applications: ICC/IF
H00008706-P01
Species: Hu
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB100-74635
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56565
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Granzyme K Antibody (NBP2-49387) (0)

There are no publications for Granzyme K Antibody (NBP2-49387).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Granzyme K Antibody (NBP2-49387) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-49387:
Filter by Applications
IHC
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry Granzyme K NBP2-49387
Enlarge
reviewed by:
Anonymous
IHC Human 06/16/2017
View

Summary

ApplicationImmunohistochemistry
Sample Testedhuman skin
SpeciesHuman
LotR88017

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme K Antibody (NBP2-49387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Granzyme K Antibody (NBP2-49387)

Discover related pathways, diseases and genes to Granzyme K Antibody (NBP2-49387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme K Antibody (NBP2-49387)

Discover more about diseases related to Granzyme K Antibody (NBP2-49387).
 

Pathways for Granzyme K Antibody (NBP2-49387)

View related products by pathway.

PTMs for Granzyme K Antibody (NBP2-49387)

Learn more about PTMs related to Granzyme K Antibody (NBP2-49387).

Blogs on Granzyme K

There are no specific blogs for Granzyme K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Anonymous
06/16/2017
Application: IHC
Species: Human

Bioinformatics

Gene Symbol GZMK
Entrez