Granzyme K Antibody


Western Blot: Granzyme K Antibody [NBP2-49387] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining in human tonsil and cerebral cortex tissues using anti-GZMK antibody. Corresponding GZMK RNA-seq data are more
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: Granzyme K Antibody [NBP2-49387] - Staining of human tonsil shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Granzyme K Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KCKVTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCAGDAKGQKDS
Specificity of human Granzyme K antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Granzyme K Recombinant Protein Antigen (NBP2-49387PEP)
Reviewed Applications
Read 1 Review rated 5
NBP2-49387 in the following applications:

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Granzyme K Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC
  • Fragmentin-3
  • Granzyme 3
  • granzyme K (granzyme 3; tryptase II)
  • granzyme K (serine protease, granzyme 3; tryptase II)
  • Granzyme K
  • Granzyme-3
  • Granzyme-K
  • GZMK
  • NK-Tryp-2
  • NK-Tryptase-2
  • PRSS
  • TRYP2
  • TRYP2granzyme-3
  • Tryptase II


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: ICC/IF
Species: Hu
Species: Mu, Rt
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD

Publications for Granzyme K Antibody (NBP2-49387) (0)

There are no publications for Granzyme K Antibody (NBP2-49387).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Granzyme K Antibody (NBP2-49387) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP2-49387:
Filter by Applications
All Applications
Filter by Species
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry Granzyme K NBP2-49387
reviewed by:
IHC Human 06/16/2017


Sample Testedhuman skin

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Granzyme K Antibody (NBP2-49387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Granzyme K Antibody (NBP2-49387)

Discover related pathways, diseases and genes to Granzyme K Antibody (NBP2-49387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Granzyme K Antibody (NBP2-49387)

Discover more about diseases related to Granzyme K Antibody (NBP2-49387).

Pathways for Granzyme K Antibody (NBP2-49387)

View related products by pathway.

PTMs for Granzyme K Antibody (NBP2-49387)

Learn more about PTMs related to Granzyme K Antibody (NBP2-49387).

Blogs on Granzyme K

There are no specific blogs for Granzyme K, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Recent Reviews


Application: IHC
Species: Human


Gene Symbol GZMK