Nucleoporin NUP85/Pericentrin 1 Antibody


Western Blot: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-31860] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-31860] - Staining in human testis and skeletal muscle tissues using anti-NUP85 antibody. Corresponding NUP85 RNA-seq data are presented for more
Immunohistochemistry-Paraffin: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-31860] - Pericentrin 1 Antibody [NBP2-31860] - Staining of human oral mucosa shows moderate nucleolar positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-31860] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Nucleoporin NUP85/Pericentrin 1 Antibody [NBP2-31860] - Staining of human testis shows high expression.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Nucleoporin NUP85/Pericentrin 1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: DGEPTVTLIPGVNSKKNQMYFDWGPGEMLVCETSFNKKEKSEMVPSCPFIYIIRKDVDVYSQILRKLFNESHGIFL
Specificity of human Nucleoporin NUP85/Pericentrin 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nucleoporin NUP85/Pericentrin 1 Protein (NBP2-31860PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (87%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Nucleoporin NUP85/Pericentrin 1 Antibody

  • 85 kDa nucleoporin
  • FLJ12549
  • nuclear pore complex protein Nup85
  • nucleoporin 85kDa
  • Nucleoporin Nup75
  • Nucleoporin Nup85
  • Nucleoporin
  • Nup75
  • NUP85
  • PCNT
  • PCNT1
  • Pericentrin-1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Bv, Eq, Pm
Applications: IHC-P
Species: Hu, Mu, Rt, Po, ChHa, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: IHC-P
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860) (0)

There are no publications for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860) (0)

There are no reviews for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860)

Discover related pathways, diseases and genes to Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860)

Discover more about diseases related to Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860).

Pathways for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860)

View related products by pathway.

PTMs for Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860)

Learn more about PTMs related to Nucleoporin NUP85/Pericentrin 1 Antibody (NBP2-31860).

Blogs on Nucleoporin NUP85/Pericentrin 1

There are no specific blogs for Nucleoporin NUP85/Pericentrin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Nucleoporin NUP85/Pericentrin 1 Antibody and receive a gift card or discount.


Gene Symbol NUP85