NUP133 Antibody (3E8) - Azide and BSA Free Summary
Description
Novus Biologicals Mouse NUP133 Antibody (3E8) - Azide and BSA Free (H00055746-M01) is a monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-NUP133 Antibody: Cited in 4 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
NUP133 (NP_060700, 1069 a.a. ~ 1155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQKLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQ
Specificity
NUP133 (3E8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NUP133
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NUP133 Antibody (3E8) - Azide and BSA Free
FLJ10814
hNUP133,133 kDa nucleoporin
MGC21133
nuclear pore complex protein Nup133
nucleoporin 133kD
nucleoporin 133kDa
Nucleoporin Nup133
Background
The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. The nucleoporin protein encoded by this gene displays evolutionarily conserved interactions with other nucleoporins. This protein, which localizes to both sides of the nuclear pore complex at interphase, remains associated with the complex during mitosis and is targeted at early stages to the reforming nuclear envelope. This protein also localizes to kinetochores of mitotic cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our NUP133 Antibody (3E8) - Azide and BSA Free and receive a gift card or discount.