Nucleoplasmin-2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Nucleoplasmin-2 Antibody [NBP2-13673] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human pancreas shows strong nuclear positivity in islet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nucleoplasmin-2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GSGPVFLSGQERYEASDLTWEEEEEEEGEEEEEEEEDDEDEDADISLEEQ SPVKQVKRLVPQKQASVAKKKKLEKEEEEIRASVRDKSPVKKAKATARAK KPGFKK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPM2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
Nucleoplasmin-2 Protein (NBP2-13673PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nucleoplasmin-2 Antibody

  • MGC78655
  • nucleophosmin/nucleoplasmin 2
  • nucleoplasmin-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-90999
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-17958
Species: Hu
NBP1-76289
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, ICC
H00344018-P01
Species: Hu
NBP1-86823
Species: Hu
Applications: IHC, IHC-P
NBP2-33910
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00353238-R01
Species: Hu
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46193
Species: Hu
Applications: WB, IHC
NBP2-30830
Species: Hu
Applications: IHC, IHC-P
NBP1-86103
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-17349
Species: Hu
NBP2-02619
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF7550
Species: Hu
Applications: WB

Publications for Nucleoplasmin-2 Antibody (NBP2-13673) (0)

There are no publications for Nucleoplasmin-2 Antibody (NBP2-13673).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nucleoplasmin-2 Antibody (NBP2-13673) (0)

There are no reviews for Nucleoplasmin-2 Antibody (NBP2-13673). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nucleoplasmin-2 Antibody (NBP2-13673) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nucleoplasmin-2 Products

Bioinformatics Tool for Nucleoplasmin-2 Antibody (NBP2-13673)

Discover related pathways, diseases and genes to Nucleoplasmin-2 Antibody (NBP2-13673). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-2 Antibody (NBP2-13673)

Discover more about diseases related to Nucleoplasmin-2 Antibody (NBP2-13673).
 

Pathways for Nucleoplasmin-2 Antibody (NBP2-13673)

View related products by pathway.

PTMs for Nucleoplasmin-2 Antibody (NBP2-13673)

Learn more about PTMs related to Nucleoplasmin-2 Antibody (NBP2-13673).

Blogs on Nucleoplasmin-2

There are no specific blogs for Nucleoplasmin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleoplasmin-2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPM2