Nucleoplasmin-3 Antibody

Images

 
Western Blot: Nucleoplasmin-3 Antibody [NBP1-90999] - Analysis in control (vector only transfected HEK293T lysate) and NPM3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Nucleoplasmin-3 Antibody [NBP1-90999] - Staining of human vulva/anal skin shows strong nucleolar and cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nucleoplasmin-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nucleoplasmin-3 Protein (NBP1-90999PEP)
Publications
Read Publication using
NBP1-90999 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nucleoplasmin-3 Antibody

  • nucleophosmin/nucleoplasmin 3
  • nucleophosmin/nucleoplasmin family, member 3
  • nucleoplasmin-3
  • PORMIN
  • TMEM123

Background

Nucleoplasmin-3 is encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
423-F8
Species: Hu, Mu
Applications: BA
NBP2-13673
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07996
Species: Hu
Applications: WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF-242-PB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
NBP1-52105
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00008294-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-33910
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-07755
Species: Hu
Applications: WB
NLS3775
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB21-2024
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB

Publications for Nucleoplasmin-3 Antibody (NBP1-90999)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Nucleoplasmin-3 Antibody (NBP1-90999) (0)

There are no reviews for Nucleoplasmin-3 Antibody (NBP1-90999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoplasmin-3 Antibody (NBP1-90999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nucleoplasmin-3 Products

Bioinformatics Tool for Nucleoplasmin-3 Antibody (NBP1-90999)

Discover related pathways, diseases and genes to Nucleoplasmin-3 Antibody (NBP1-90999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-3 Antibody (NBP1-90999)

Discover more about diseases related to Nucleoplasmin-3 Antibody (NBP1-90999).
 

Pathways for Nucleoplasmin-3 Antibody (NBP1-90999)

View related products by pathway.

PTMs for Nucleoplasmin-3 Antibody (NBP1-90999)

Learn more about PTMs related to Nucleoplasmin-3 Antibody (NBP1-90999).
 

Research Areas for Nucleoplasmin-3 Antibody (NBP1-90999)

Find related products by research area.

Blogs on Nucleoplasmin-3

There are no specific blogs for Nucleoplasmin-3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleoplasmin-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPM3