Home » Nucleoplasmin-3 » Nucleoplasmin-3 Antibodies » Nucleoplasmin-3 Antibody

Nucleoplasmin-3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Nucleoplasmin-3 Antibody [NBP1-90999] - Analysis in control (vector only transfected HEK293T lysate) and NPM3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Nucleoplasmin-3 Antibody [NBP1-90999] - Analysis in control (vector only transfected HEK293T lysate) and NPM3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian ...read more
Immunohistochemistry-Paraffin: Nucleoplasmin-3 Antibody [NBP1-90999] - Staining of human vulva/anal skin shows strong nucleolar and cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Nucleoplasmin-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Nucleoplasmin-3 Protein (NBP1-90999PEP)
Publications
Read Publication using
NBP1-90999 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nucleoplasmin-3 Antibody

  • nucleophosmin/nucleoplasmin 3
  • nucleophosmin/nucleoplasmin family, member 3
  • nucleoplasmin-3
  • PORMIN
  • TMEM123

Background

Nucleoplasmin-3 is encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in OCI-AML3 cells.
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in HL-60 cells (negative control).
Western Blot: Nucleophosmin Antibody [NB110-61646] - Detection of mutant Nucleophosmin in OCI-AML3 lysates.
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
FGF-8
[Unconjugated]
423-F8
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
(1 Review)
(57 Publications)
Species: Hu, Mu
Applications: BA
Nucleoplasmin-2
Antibody
NBP2-13673
Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human parathyroid gland shows high expression.
Immunocytochemistry/Immunofluorescence: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA: H4/n Antibody (3E7H2) [NBP2-52486] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).
Western Blot: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis using HIST2H4A(20Me) mouse mAb against THP-1 (1) cell lysate.
Flow Cytometry: H4/n Antibody (3E7H2) [NBP2-52486] - Analysis of Raji cells using HIST2H4A(20Me) mouse mAb (green) and negative control (red).
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TGF-beta RIII
Antibody [Unconjugate
AF-242-PB
PC‑3 human prostate cancer cell line was stained with Goat Anti-Human TGF‑ beta  RIII Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF‑242‑PB, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Fluorescein-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0109).
TGF‑ beta  RIII was detected in immersion fixed paraffin-embedded sections of human placenta tissue using Goat Anti-Human TGF‑ beta  RIII Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-242-PB) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to cell surface on syncytiotrophoblast cells. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
MCF-7 human breast adenocarcinoma cell line was stained with Goat Anti-Human TGF-beta RIII Antigen Affinity-purified Polyclonal Antibody (Catalog # AF-242-PB, filled histogram) or control antibody (AB-108-C, open histogram), followed by PE-conjugated Anti-Goat IgG Secondary Antibody (F0107).
(9 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
DCTN3 Antibody
NBP1-52105
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-52105] - Staining (8ug/ml) of paraffin embedded Human Kidney. Heat induced antigen retrieval with citrate buffer pH 6, HRP-Staining.
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-52105] - Negative Control showing staining of paraffin embedded Human Kidney, with no primary antibody.
Western Blot: DCTN3 Antibody [NBP1-52105] - Staining (0.2ug/ml) of Mouse (A) and Rat (B) Skeletal Muscle lysates (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu, Rt
Applications: Flow, IHC, IHC-P, PEP-ELISA, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded SW480 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Recombinant Human
HIST1H4I GST (N-Term) ...
H00008294-P01
SDS-Page: Recombinant Human HIST1H4I Protein [H00008294-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NASP Antibody
NBP2-33910
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33910] - Staining in human testis and pancreas tissues using anti-NASP antibody. Corresponding NASP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
TNP2
Overexpression Lysate
NBP2-07755
Western Blot: TNP2 Overexpression Lysate (Adult Normal) [NBP2-07755] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for TNP2.
Species: Hu
Applications: WB
Histamine H4R
Antibody - BSA Free
NLS3775
Immunohistochemistry-Paraffin: Histamine H4R Antibody [NLS3775] - Ovary, carcinoma
Immunohistochemistry-Paraffin: Histamine H4R Antibody [NLS3775] - Pancreas, carcinoma
Immunohistochemistry-Paraffin: Histamine H4R Antibody [NLS3775] - Colon, Carcinoma
(1 Publication)
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on Raw264.7 cells with KAT3B/p300 Antibody (RW105) NB100-616 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 1.0 ug/mL for 30 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B/p300 Antibody (RW105) NB100-616 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(9 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CCDC6 Antibody
NBP1-85351
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Histone H4 [ac
Lys5] Antibody - BSA ...
NB21-2024
Immunocytochemistry/Immunofluorescence: Histone H4 [ac Lys5] Antibody [NB21-2024] - Histone H4 K5ac antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Chromatin Immunoprecipitation: Histone H4 [ac Lys5] Antibody [NB21-2024] - 2 ug of NB21-2024 was used to IP DNA from fixed Hela cells alongside a no antibody (No Ab) control. DNA was measured by qRT-PCR and normalized to total input (input=1).
Western Blot: Histone H4 [ac Lys5] Antibody [NB21-2024] - Analysis of H4K5ac in HeLa histone prep.
(2 Reviews)
(2 Publications)
Species: Hu, Ma, Mu, Po, Rt
Applications: ChIP, DB, ICC/IF, WB

Publications for Nucleoplasmin-3 Antibody (NBP1-90999)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Nucleoplasmin-3 Antibody (NBP1-90999) (0)

There are no reviews for Nucleoplasmin-3 Antibody (NBP1-90999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoplasmin-3 Antibody (NBP1-90999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Nucleoplasmin-3 Products

Bioinformatics Tool for Nucleoplasmin-3 Antibody (NBP1-90999)

Discover related pathways, diseases and genes to Nucleoplasmin-3 Antibody (NBP1-90999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-3 Antibody (NBP1-90999)

Discover more about diseases related to Nucleoplasmin-3 Antibody (NBP1-90999).
 

Pathways for Nucleoplasmin-3 Antibody (NBP1-90999)

View related products by pathway.

PTMs for Nucleoplasmin-3 Antibody (NBP1-90999)

Learn more about PTMs related to Nucleoplasmin-3 Antibody (NBP1-90999).
 

Research Areas for Nucleoplasmin-3 Antibody (NBP1-90999)

Find related products by research area.

Blogs on Nucleoplasmin-3

There are no specific blogs for Nucleoplasmin-3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleoplasmin-3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NPM3