Nucleoplasmin-3 Antibody - BSA Free

Immunohistochemistry-Paraffin: Nucleoplasmin-3 Antibody [NBP1-90999] - Staining of human vulva/anal skin shows strong nucleolar and cytoplasmic positivity in squamous epithelial cells.

Analysis in control (vector only transfected HEK293T lysate) and NPM3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nucleoplasmin-3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Nucleoplasmin-3 Antibody - BSA Free (NBP1-90999) is a polyclonal antibody validated for use in IHC and WB. Anti-Nucleoplasmin-3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPM3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Nucleoplasmin-3 Protein (NBP1-90999PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nucleoplasmin-3 Antibody - BSA Free

• nucleophosmin/nucleoplasmin 3
• nucleophosmin/nucleoplasmin family, member 3
• nucleoplasmin-3
• PORMIN
• TMEM123

Background

Nucleoplasmin-3 is encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nucleoplasmin-3 Antibody (NBP1-90999)(1)

Publication using NBP1-90999

• Hernandez-Ortega K, Garcia-Esparcia P, Gil L et al. Altered machinery of protein synthesis in Alzheimer's: from the nucleolus to the ribosome. Brain Pathol. 2015-10-29 [PMID: 26512942] (IHC-P, Human)
  
  Details:
  Nucleoplasmin 3 (NPM3) antibody was used at 1:200 dilution for IHC-P on tissues from middle-aged and Alzheimer’s disease stages I–VI

Bioinformatics

• Gene Symbol: NPM3