Home » Nucleoplasmin-3 » Nucleoplasmin-3 Antibodies » Nucleoplasmin-3 Antibody

Nucleoplasmin-3 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Nucleoplasmin-3 Antibody [NBP1-90999] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: Nucleoplasmin-3 Antibody [NBP1-90999] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate ...read more
Immunohistochemistry-Paraffin: Nucleoplasmin-3 Antibody [NBP1-90999] - Staining of human vulva/anal skin shows strong nucleolar and cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Nucleoplasmin-3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSE
Specificity
Specificity of human Nucleoplasmin-3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPM3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control
Nucleoplasmin-3 Lysate (NBP2-66010)
Control Peptide
Nucleoplasmin-3 Protein (NBP1-90999PEP)
Publications
Read Publication using
NBP1-90999 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nucleoplasmin-3 Antibody

  • nucleophosmin/nucleoplasmin 3
  • nucleophosmin/nucleoplasmin family, member 3
  • nucleoplasmin-3
  • PORMIN
  • TMEM123

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NPM1 Antibody
NB110-61646
Western Blot: Nucleophosmin Antibody [NB110-61646] - Detection of mutant Nucleophosmin in OCI-AML3 lysates.
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in HL-60 cells (negative control).
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in OCI-AML3 cells.
(2 Reviews)
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
FGF-8
[Unconjugated]
423-F8
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
(2 Reviews)
(39 Publications)
Species: Hu, Mu
Nucleoplasmin-2
Antibody
NBP2-13673
Immunocytochemistry/Immunofluorescence: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human cell line U-2 OS shows localization to nucleus and nucleoli.
Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining in human parathyroid gland and liver tissues using anti-NPM2 antibody. Corresponding NPM2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Nucleoplasmin-2 Antibody [NBP2-13673] - Staining of human pancreas shows strong nuclear positivity in islet cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.
Species: Hu
H4/n Antibody
(3E7D9)
NBP2-52487
Immunohistochemistry: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of paraffin-embedded esophageal cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Immunohistochemistry: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of paraffin-embedded colon cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Immunofluorescence: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of HeLa cells. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
TGF-beta RIII
Antibody
AF-242-PB
PC‑3 human prostate cancer cell line was stained with Goat Anti-Human TGF‑ beta  RIII Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF‑242‑PB, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Fluorescein-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0109).
(8 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
DCTN3 Antibody
NBP1-91823
Immunocytochemistry/Immunofluorescence: DCTN3 Antibody [NBP1-91823] - Staining of human cell line A-431 shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: DCTN3 Antibody [NBP1-91823] - Staining of human pancreas shows distinct cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Calcium-binding-protei
NBP1-33736
Western Blot: Calcium-binding-protein-P22 Antibody [NBP1-33736] - A. 50 ug mouse liver lysate/extract 12 % SDS-PAGE
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Recombinant Human
HIST1H4I Protein
H00008294-P01
SDS-Page: Recombinant Human HIST1H4I Protein [H00008294-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu

O-GlcNAcase/OGA/MGEA5
NBP1-81244
Western Blot: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Analysis in human cell line A-431.
Immunohistochemistry-Paraffin: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Staining of human testis shows strong cytoplasmic positivity in spermatogonia in seminiferus ducts.
Western Blot: O-GlcNAcase/OGA/MGEA5 Antibody [NBP1-81244] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MMTV Antibody
NBP2-44179
Western Blot: MMTV Antibody [NBP2-44179] - lane 1: cell lysate negative control. Lane 2: cell lysate spiked with purified virus. Load: 10 Ug per lane.
Species: Mu
Applications: WB, ELISA
NASP Antibody
NBP2-33928
Western Blot: NASP Antibody [NBP2-33928] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-NASP antibody. Remaining relative intensity is presented.
Immunocytochemistry/Immunofluorescence: NASP Antibody [NBP2-33928] - Staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: NASP Antibody [NBP2-33928] - Staining in human testis and pancreas tissues using anti-NASP antibody. Corresponding NASP RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
TNP2
Overexpression Lysate
NBP2-07755
Western Blot: TNP2 Overexpression Lysate (Adult Normal) [NBP2-07755] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for TNP2.
Species: Hu
Histamine H4 R
Antibody
NLS3775
Immunohistochemistry-Paraffin: Histamine H4 R Antibody [NLS3775] - Anti-HRH4 / Histamine H4 Receptor antibody IHC of human Ovary, Carcinoma and Inflammatory Cells. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.
Immunohistochemistry-Paraffin: Histamine H4 R Antibody [NLS3775] - IHC analysis of Lymph node using this antibody at 12 ug/ ml.
Species: Hu, Mk
Applications: ICC/IF, IHC-P
KAT3B/p300
Antibody (RW105)
NB100-616
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-KAT3B/p300 [RW105] at 5 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Flow (Intracellular): KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(9 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
DYNC1H1 Antibody
NBP1-84254
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: DYNC1H1 Antibody [NBP1-84254] - Staining in human cerebral cortex and pancreas tissues using anti-DYNC1H1 antibody. Corresponding DYNC1H1 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CCDC6 Antibody
NBP1-85351
Western Blot: CCDC6 Antibody [NBP1-85351] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: CCDC6 Antibody [NBP1-85351] - Staining of human cell line U-251 MG shows localization to cytosol.
Immunohistochemistry-Paraffin: CCDC6 Antibody [NBP1-85351] - Staining in human fallopian tube and skeletal muscle tissues using anti-CCDC6 antibody. Corresponding CCDC6 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Histone H4 [ac
Lys5] Antibody
NB21-2024
Western Blot: Histone H4 [ac Lys5] Antibody [NB21-2024] - WB analysis of H4K5ac in NIH 3t3 histone prep.
Immunocytochemistry/Immunofluorescence: Histone H4 [ac Lys5] Antibody [NB21-2024] - Histone H4 K5ac antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Chromatin Immunoprecipitation: Histone H4 [ac Lys5] Antibody [NB21-2024] - 2 ug of NB21-2024 was used to IP DNA from fixed Hela cells alongside a no antibody (No Ab) control. DNA was measured by qRT-PCR and normalized to total input (input=1).
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF

Publications for Nucleoplasmin-3 Antibody (NBP1-90999)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Nucleoplasmin-3 Antibody (NBP1-90999) (0)

There are no reviews for Nucleoplasmin-3 Antibody (NBP1-90999). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nucleoplasmin-3 Antibody (NBP1-90999) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Nucleoplasmin-3 Knockout 293T Cell Lysate

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nucleoplasmin-3 Antibody (NBP1-90999)

Discover related pathways, diseases and genes to Nucleoplasmin-3 Antibody (NBP1-90999). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nucleoplasmin-3 Antibody (NBP1-90999)

Discover more about diseases related to Nucleoplasmin-3 Antibody (NBP1-90999).
 

Pathways for Nucleoplasmin-3 Antibody (NBP1-90999)

View related products by pathway.

PTMs for Nucleoplasmin-3 Antibody (NBP1-90999)

Learn more about PTMs related to Nucleoplasmin-3 Antibody (NBP1-90999).

Blogs on Nucleoplasmin-3

There are no specific blogs for Nucleoplasmin-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nucleoplasmin-3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NPM3