Nucleolar Protein 4 Like Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: C20orf112 Antibody [NBP1-94114] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human cerebral cortex.

Immunohistochemistry: C20orf112 Antibody [NBP1-94114] - Staining of human rectum shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining in human testis and endometrium tissues using anti-NOL4L antibody. Corresponding NOL4L RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human cerebral cortex, colon, kidney and testis using Anti-NOL4L antibody NBP1-94114 (A) shows similar protein distribution across tissues to independent antibody NBP1-94115 (B).

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human colon.

Immunohistochemistry-Paraffin: C20orf112 Antibody [NBP1-94114] - Staining of human kidney.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nucleolar Protein 4 Like Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SDGCGADGLRSRVKYGVKTTPESPPYSSGSYDSIKTEVSGCPEDLTVGRAPTADDDDDDHDDHEDNDKMNDSEGMDPERL
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C20orf112
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Nucleolar Protein 4 Like Recombinant Protein Antigen (NBP1-94114PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Nucleolar Protein 4 Like Antibody - BSA Free

• hypothetical protein LOC100506597
• LOC100506597

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C20orf112