ATP9A Antibody - BSA Free

Immunohistochemistry-Paraffin: ATP9A Antibody [NBP1-88905] - Analysis in human cerebral cortex and tonsil tissues using NBP1-88905 antibody. Corresponding ATP9A RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ATP9A Antibody [NBP1-88905] - Staining of human Testis shows strong granular cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: ATP9A Antibody [NBP1-88905] - Staining of human Cerebral cortex shows strong granular cytoplasmic positivity in neuronal and glial cells.

Immunohistochemistry-Paraffin: ATP9A Antibody [NBP1-88905] - Staining of human Pancreas shows strong granular cytoplasmic positivity in islets of Langerhans.

Immunohistochemistry-Paraffin: ATP9A Antibody [NBP1-88905] - Staining of human Tonsil shows no positivity in germinal center cells as expected.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ATP9A Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGG
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATP9A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ATP9A Protein (NBP1-88905PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATP9A Antibody - BSA Free

• ATPase class II type 9A
• ATPase type IV, phospholipid-transporting (P-type)
• ATPase, class II, type 9A
• ATPIIAphospholipid-transporting ATPase IIA
• EC 3.6.3
• EC 3.6.3.1
• KIAA0611probable phospholipid-transporting ATPase IIA

Background

ATP9A - ATPase, Class II, type 9A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ATP9A