ATP9A Antibody


Western Blot: ATP9A Antibody [NBP1-88905] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-53
Immunohistochemistry-Paraffin: ATP9A Antibody [NBP1-88905] - Staining of human testis shows strong cytoplasmic and nuclear positivity in Leydig cells.

Product Details

Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ATP9A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGG
Specificity of human, mouse, rat ATP9A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ATP9A Protein (NBP1-88905PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ATP9A Antibody

  • ATPase class II type 9A
  • ATPase type IV, phospholipid-transporting (P-type)
  • ATPase, class II, type 9A
  • ATPIIAphospholipid-transporting ATPase IIA
  • EC 3.6.3
  • EC
  • KIAA0611probable phospholipid-transporting ATPase IIA


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IF
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IF
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for ATP9A Antibody (NBP1-88905) (0)

There are no publications for ATP9A Antibody (NBP1-88905).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATP9A Antibody (NBP1-88905) (0)

There are no reviews for ATP9A Antibody (NBP1-88905). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ATP9A Antibody (NBP1-88905) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ATP9A Products

Bioinformatics Tool for ATP9A Antibody (NBP1-88905)

Discover related pathways, diseases and genes to ATP9A Antibody (NBP1-88905). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATP9A Antibody (NBP1-88905)

Discover more about diseases related to ATP9A Antibody (NBP1-88905).

Pathways for ATP9A Antibody (NBP1-88905)

View related products by pathway.

Blogs on ATP9A

There are no specific blogs for ATP9A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ATP9A Antibody and receive a gift card or discount.


Gene Symbol ATP9A