NSUN5 Recombinant Protein Antigen

Images

 
There are currently no images for NSUN5 Recombinant Protein Antigen (NBP2-58249PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NSUN5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NSUN5.

Source: E. coli

Amino Acid Sequence: MPSRQLEDPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NSUN5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58249.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NSUN5 Recombinant Protein Antigen

  • EC 2.1.1.-
  • FLJ10267
  • member 5A
  • MGC986
  • NOL1
  • NOL1/NOP2/Sun domain family member 5
  • NOL1/NOP2/Sun domain family, member 5
  • NOL1R(NOL1)
  • NOL1-related protein
  • NOP2/Sun domain family, member 5
  • NSUN5A
  • p120
  • putative methyltransferase NSUN5
  • WBSCR20
  • WBSCR20A
  • Williams-Beuren syndrome chromosomal region 20A protein
  • Williams-Beuren syndrome critical region protein 20 copy A
  • Ynl022cL

Background

NSUN5 encodes a protein with similarity to p120 (NOL1), a 120-kDa proliferation-associated nucleolar antigen that is a member of an evolutionarily conserved protein family. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF5094
Species: Hu, Mu, Rt
Applications: WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
236-EG
Species: Hu
Applications: BA
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-86588
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
DRT100
Species: Hu
Applications: ELISA
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1002
Species: Mu
Applications: Dual ISH-IHC, IHC, Simple Western, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
NBP2-58249PEP
Species: Hu
Applications: AC

Publications for NSUN5 Recombinant Protein Antigen (NBP2-58249PEP) (0)

There are no publications for NSUN5 Recombinant Protein Antigen (NBP2-58249PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSUN5 Recombinant Protein Antigen (NBP2-58249PEP) (0)

There are no reviews for NSUN5 Recombinant Protein Antigen (NBP2-58249PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NSUN5 Recombinant Protein Antigen (NBP2-58249PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NSUN5 Products

Research Areas for NSUN5 Recombinant Protein Antigen (NBP2-58249PEP)

Find related products by research area.

Blogs on NSUN5

There are no specific blogs for NSUN5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NSUN5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NSUN5