NSP 5 alpha 3 alpha Antibody


Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: NSP 5 alpha 3 alpha Antibody [NBP1-85353] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

NSP 5 alpha 3 alpha Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSD
Specificity of human, mouse NSP 5 alpha 3 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NSP 5 alpha 3 alpha Protein (NBP1-85353PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (84%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for NSP 5 alpha 3 alpha Antibody

  • cytospin-B
  • CYTSBcytospin B
  • FLJ36955
  • HCMOGT-1
  • NSP
  • NSP5
  • Nuclear structure protein 5
  • sperm antigen HCMOGT 1
  • Sperm antigen HCMOGT-1
  • sperm antigen with calponin homology and coiled coil domains 1
  • sperm antigen with calponin homology and coiled-coil domains 1cytokinesis and spindle organization B
  • sperm antigen with calponin-like and coiled coil domains 1
  • structure protein NSP5a3a
  • structure protein NSP5a3b
  • structure protein NSP5b3a
  • structure protein NSP5b3b


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Rt
Applications: WB, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ha
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
Species: Hu
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for NSP 5 alpha 3 alpha Antibody (NBP1-85353) (0)

There are no publications for NSP 5 alpha 3 alpha Antibody (NBP1-85353).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NSP 5 alpha 3 alpha Antibody (NBP1-85353) (0)

There are no reviews for NSP 5 alpha 3 alpha Antibody (NBP1-85353). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NSP 5 alpha 3 alpha Antibody (NBP1-85353) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional NSP 5 alpha 3 alpha Products

Bioinformatics Tool for NSP 5 alpha 3 alpha Antibody (NBP1-85353)

Discover related pathways, diseases and genes to NSP 5 alpha 3 alpha Antibody (NBP1-85353). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NSP 5 alpha 3 alpha Antibody (NBP1-85353)

Discover more about diseases related to NSP 5 alpha 3 alpha Antibody (NBP1-85353).

Pathways for NSP 5 alpha 3 alpha Antibody (NBP1-85353)

View related products by pathway.

Research Areas for NSP 5 alpha 3 alpha Antibody (NBP1-85353)

Find related products by research area.

Blogs on NSP 5 alpha 3 alpha

There are no specific blogs for NSP 5 alpha 3 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our NSP 5 alpha 3 alpha Antibody and receive a gift card or discount.


Gene Symbol SPECC1