NRSF Antibody - BSA Free

Western Blot: NRSF Antibody [NBP1-82399] - Mouse Heart Lysate 1ug/ml Gel Concentration 6-18%

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NRSF Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide towards Rest. Peptide sequence ANMGMALTNDMYDLHELSKAELAAPQLIMLANVALTGEASGSCCDYLVGE. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: REST
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunohistochemistry-frozen and Immunocytochemistry/Immunofluorescence reported in scientific literature (PMID:31706914).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NRSF Antibody - BSA Free

• Neural-restrictive silencer factor
• NRSFneuron restrictive silencer factor
• RE1-silencing transcription factor
• X2 box repressor
• XBRrepressor binding to the X2 box

Background

REST, which is short for RE1-silencing transcription factor, locks down neuronal genes in other cells by grabbing onto the DNA and cementing in other molecules, an arrangement that stays intact as non-neuronal cells differentiate into liver, muscle, and other tissues. REST uses a different temporary off mechanism to direct neuronal development. REST is a tumor suppressor gene in epithelial cells and has been found to be mutated in 33 percent of colorectal tumors and cell lines studied. Rest could eventually serve as a marker for diagnosing colorectal and other types of cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NRSF Antibody (NBP1-82399)(2)

Publications using NBP1-82399

• Xue WJ, He CF, Zhou RY et al. High glucose and palmitic acid induces neuronal senescence by NRSF/REST elevation and the subsequent mTOR-related autophagy suppression Molecular brain 2022-07-18 [PMID: 35850767]

Bioinformatics

• Gene Symbol: REST
• Uniprot:
  • NP_035393(Mouse)