NRG4 Antibody - BSA Free

Immunohistochemistry-Paraffin: NRG4 Antibody [NBP1-81709] - Staining of human cerebellum shows strong cytoplasmic positivity in processes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NRG4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NRG4 Antibody - BSA Free (NBP1-81709) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NRG4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NRG4 Protein (NBP1-81709PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (88%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NRG4 Antibody - BSA Free

• DKFZp779N0541
• DKFZp779N1944
• heregulin 4
• HRG4pro-NRG4
• neuregulin 4
• pro-neuregulin-4, membrane-bound isoform
• Pro-NRG4

Background

Plasmid: pCMV-NRG4 Full length

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NRG4