UNC119 Antibody (2F9-2A9)

Images

 
Western Blot: UNC119 Antibody (2F9-2A9) [H00009094-M01] - Primary antibody: 1:1000, 4 degree, overnight. Secondary antibody: 1:3000 HRP-antimouse IgG 37 degree, 3 hr. This image was submitted via customer Review.
Western Blot: UNC119 Antibody (2F9-2A9) [H00009094-M01] - Analysis of UNC119 expression in transfected 293T cell line by UNC119 monoclonal antibody (M01), clone 2F9-2A9.Lane 1: UNC119 transfected lysate(27 KDa).Lane 2: ...read more
Immunoprecipitation: UNC119 Antibody (2F9-2A9) [H00009094-M01] - Analysis of UNC119 transfected lysate using anti-UNC119 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with UNC119 purified MaxPab ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, IP
Clone
2F9-2A9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

UNC119 Antibody (2F9-2A9) Summary

Immunogen
UNC119 (AAH27176.1, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP
Specificity
UNC119 - unc-119 homolog (C. elegans)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
UNC119
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Reviewed Applications
Read 1 Review rated 3
using
H00009094-M01 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for UNC119 Antibody (2F9-2A9)

  • hRG4
  • HRG4POC7 centriolar protein homolog A
  • POC7
  • POC7A
  • protein unc-119 homolog A
  • Retinal protein 4
  • RG4
  • unc119 (C.elegans) homolog
  • unc-119 homolog (C. elegans)

Background

This gene is specifically expressed in the photoreceptors in the retina. The encoded product shares strong homology with the C. elegans unc119 protein and it can functionally complement the C. elegans unc119 mutation. It has been localized to the photoreceptor synapses in the outer plexiform layer of the retina, and suggested to play a role in the mechanism of photoreceptor neurotransmitter release through the synaptic vesicle cycle. Two transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30939
Species: Hu, Mu, Rt
Applications: WB
MAB7500
Species: Hu
Applications: WB, ICC
NBP1-59594
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46542
Species: Hu
Applications: WB, IHC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2335
Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33120
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-56852
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83543
Species: Hu
Applications: IHC, IHC-P
NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP2-71602
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
H00009094-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP

Publications for UNC119 Antibody (H00009094-M01) (0)

There are no publications for UNC119 Antibody (H00009094-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for UNC119 Antibody (H00009094-M01) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse and Rat.

Reviews using H00009094-M01:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Mouse and Rat
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot UNC119 H00009094-M01
Enlarge
3
reviewed by:
Taira Mayanagi
WB Mouse and Rat 09/04/2017
View

Summary

ApplicationWestern Blot
Sample Testedmouse eye,mouse hippocampus,Cultured rat embryonic hippocampal neurons
SpeciesMouse and Rat
Lot7058-S2*Aa6

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for UNC119 Antibody (H00009094-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional UNC119 Products

Bioinformatics Tool for UNC119 Antibody (H00009094-M01)

Discover related pathways, diseases and genes to UNC119 Antibody (H00009094-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for UNC119 Antibody (H00009094-M01)

Discover more about diseases related to UNC119 Antibody (H00009094-M01).
 

Pathways for UNC119 Antibody (H00009094-M01)

View related products by pathway.

PTMs for UNC119 Antibody (H00009094-M01)

Learn more about PTMs related to UNC119 Antibody (H00009094-M01).
 

Research Areas for UNC119 Antibody (H00009094-M01)

Find related products by research area.

Blogs on UNC119

There are no specific blogs for UNC119, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Taira Mayanagi
09/04/2017
Application: WB
Species: Mouse and Rat

Bioinformatics

Gene Symbol UNC119
Entrez
OMIM
Uniprot