NrCAM Antibody

Images

 
Western Blot: NrCAM Antibody [NBP1-88365] - Analysis in human cell line A-549.
Immunohistochemistry-Paraffin: NrCAM Antibody [NBP1-88365] - Staining of human cerebral cortex shows distinct positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NrCAM Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:REDYICYARFNHTQTIQQKQPISVKVISVDELNDTIAANLSDTEFYGAKSSRERPPTFLTPEGNASNKEELRGNVLSLECIAEGLPTPIIYWAKEDGMLPKNRTVYKNFEKTLQIIHVSEADSGNYQC
Marker
Neuronal Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRCAM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NrCAM Protein (NBP1-88365PEP)
Publications
Read Publication using NBP1-88365.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NrCAM Antibody

  • Bravo
  • hBravo
  • KIAA0343Neuronal surface protein Bravo
  • MGC138845
  • MGC138846
  • neuronal cell adhesion molecule
  • NgCAM-related cell adhesion molecule
  • ng-CAM-related
  • NrCAM
  • nr-CAM

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP1-83939
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3865
Species: Hu
Applications: WB, IHC
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-88365
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NrCAM Antibody (NBP1-88365)(1)

Reviews for NrCAM Antibody (NBP1-88365) (0)

There are no reviews for NrCAM Antibody (NBP1-88365). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NrCAM Antibody (NBP1-88365) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NrCAM Products

Bioinformatics Tool for NrCAM Antibody (NBP1-88365)

Discover related pathways, diseases and genes to NrCAM Antibody (NBP1-88365). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NrCAM Antibody (NBP1-88365)

Discover more about diseases related to NrCAM Antibody (NBP1-88365).
 

Pathways for NrCAM Antibody (NBP1-88365)

View related products by pathway.

PTMs for NrCAM Antibody (NBP1-88365)

Learn more about PTMs related to NrCAM Antibody (NBP1-88365).

Blogs on NrCAM

There are no specific blogs for NrCAM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NrCAM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRCAM
Entrez