NRAGE/MAGED1 Antibody - BSA Free

Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411] - Host: Mouse. Target Name: MAGED1. Sample Tissue: Mouse Testis. Antibody Dilution: 1ug/ml

Western Blot: NRAGE/MAGED1 Antibody [NBP1-98411] - Jurkat Cell Lysate 1.0 ug/ml, Gel Concentration: 12%

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NRAGE/MAGED1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is MAGED1 - C-terminal region. Peptide sequence ACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKLGLLLV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAGED1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 86 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NRAGE/MAGED1 Antibody - BSA Free

• Dlxin-1
• MAGE tumor antigen CCF
• MAGED1
• melanoma antigen family D, 1
• melanoma-associated antigen D1
• Neurotrophin receptor-interacting MAGE homolog
• NRAGE MAGE-D1 antigen
• NRAGE

Background

This gene is a member of the melanoma antigen gene (MAGE) family. Most of the genes of this family encode tumor specific antigens that are not expressed in normal adult tissues except testis. Although the protein encoded by this gene shares strong homology with members of the MAGE family, it is expressed in almost all normal adult tissues. This gene has been demonstrated to be involved in the p75 neurotrophin receptor mediated programmed cell death pathway. Three transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAGED1
• Uniprot:
  • NP_008917(Human)