NR4A3/NOR1 Recombinant Protein Antigen

Images

 
There are currently no images for NR4A3/NOR1 Protein (NBP1-92198PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Applications AC

Order Details

NR4A3/NOR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NR4A3.

Source: E.coli

Amino Acid Sequence: KPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR4A3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-92198.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for NR4A3/NOR1 Recombinant Protein Antigen

  • CHN
  • CSMF
  • MINOR
  • NOR1
  • TEC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB110-40415
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP1-92686
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB, ICC/IF, IHC
NBP2-45041
Species: Hu, Po
Applications: Flow, ICC/IF, IF
NBP1-19371
Species: Hu, Mu, Rt, Po, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-92685
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-49045
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NBP3-09253
Species: Dr
Applications: WB
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P

Publications for NR4A3/NOR1 Protein (NBP1-92198PEP) (0)

There are no publications for NR4A3/NOR1 Protein (NBP1-92198PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NR4A3/NOR1 Protein (NBP1-92198PEP) (0)

There are no reviews for NR4A3/NOR1 Protein (NBP1-92198PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NR4A3/NOR1 Protein (NBP1-92198PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional NR4A3/NOR1 Products

Bioinformatics Tool for NR4A3/NOR1 Protein (NBP1-92198PEP)

Discover related pathways, diseases and genes to NR4A3/NOR1 Protein (NBP1-92198PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NR4A3/NOR1 Protein (NBP1-92198PEP)

Discover more about diseases related to NR4A3/NOR1 Protein (NBP1-92198PEP).
 

Pathways for NR4A3/NOR1 Protein (NBP1-92198PEP)

View related products by pathway.

PTMs for NR4A3/NOR1 Protein (NBP1-92198PEP)

Learn more about PTMs related to NR4A3/NOR1 Protein (NBP1-92198PEP).

Blogs on NR4A3/NOR1

There are no specific blogs for NR4A3/NOR1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NR4A3/NOR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NR4A3