NPY4R Antibody - BSA Free

Immunohistochemistry-Paraffin: NPY4R Antibody [NBP1-82534] - Staining of human colon shows strong membranous and cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NPY4R Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSPRLSGRSN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPY4R
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NPY4R Protein (NBP1-82534PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NPY4R Antibody - BSA Free

• neuropeptide Y receptor type 4
• NPY4R
• NPY4RMGC116897
• pancreatic polypeptide receptor 1NPY4-R
• PP1Y4
• PPYR1

Background

NPY4R belongs to the Neuropeptide Receptor GPCR Family and may regulate central nervous system, cardiovascular, and gastrointestinal function. NPY4R has been reported to be expressed in bladder, brain, colon, endometrium, heart, lung, nasal mucosa, penis, prostate, skeletal muscle, small intestine, stomach, and vessel. ESTs have been isolated from human colon and head/neck libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NPY4R