NPRL3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NPRL3 Antibody [NBP1-88447] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: NPRL3 Antibody [NBP1-88447] - Staining of human endometrium shows positivity in glandular cells.
Immunohistochemistry-Paraffin: NPRL3 Antibody [NBP1-88447] - Staining of human prostate shows positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPRL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GDSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQISKTDPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADGNEGPQSPFHHILPKCK
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPRL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in WB reported in scientific literature (PMID:35831510).
Control Peptide
NPRL3 Protein (NBP1-88447PEP)
Publications
Read Publications using
NBP1-88447 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPRL3 Antibody

  • -14 gene protein
  • Alpha-globin regulatory element-containing gene protein
  • C16orf35
  • CGTHBAchromosome 16 open reading frame 35
  • conserved gene telomeric to alpha globin cluster
  • MAREHS-40
  • nitrogen permease regulator 3-like protein
  • nitrogen permease regulator-like 3 (S. cerevisiae)
  • NPR3
  • Protein CGTHBA
  • RMD11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-80261
Applications: ELISA
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP2-24551
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
DPG00
Species: Hu
Applications: ELISA
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-49671
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
291-G1
Species: Hu
Applications: BA
NBP3-05569
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
236-EG
Species: Hu
Applications: BA
MAB4169
Species: Hu
Applications: IHC, WB
NBP2-92077
Species: Hu, Mu, Rt
Applications: WB
NB110-41083
Species: Hu
Applications: ChIP, ELISA, ICC/IF, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

Publications for NPRL3 Antibody (NBP1-88447)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NPRL3 Antibody (NBP1-88447) (0)

There are no reviews for NPRL3 Antibody (NBP1-88447). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPRL3 Antibody (NBP1-88447) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPRL3 Products

Bioinformatics Tool for NPRL3 Antibody (NBP1-88447)

Discover related pathways, diseases and genes to NPRL3 Antibody (NBP1-88447). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPRL3 Antibody (NBP1-88447)

Discover more about diseases related to NPRL3 Antibody (NBP1-88447).
 

Pathways for NPRL3 Antibody (NBP1-88447)

View related products by pathway.

PTMs for NPRL3 Antibody (NBP1-88447)

Learn more about PTMs related to NPRL3 Antibody (NBP1-88447).

Blogs on NPRL3

There are no specific blogs for NPRL3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPRL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPRL3