NPRL3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NPRL3 Antibody [NBP1-88447] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: NPRL3 Antibody [NBP1-88447] - Staining of human skin shows strong cytoplasmic positivity in epidermal cells(basal layer).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPRL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GDSRFSDVILATILATKSEMCGQKFELKIDNVRFVGHPTLLQHALGQISKTDPSPKREAPTMILFNVVFALRANADPSVINCLHNLSRRIATVLQHEERRCQYLTREAKLILALQDEVSAMADGNEGPQSPFHHILPKCK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPRL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPRL3 Protein (NBP1-88447PEP)
Publications
Read Publication using NBP1-88447.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPRL3 Antibody

  • -14 gene protein
  • Alpha-globin regulatory element-containing gene protein
  • C16orf35
  • CGTHBAchromosome 16 open reading frame 35
  • conserved gene telomeric to alpha globin cluster
  • MAREHS-40
  • nitrogen permease regulator 3-like protein
  • nitrogen permease regulator-like 3 (S. cerevisiae)
  • NPR3
  • Protein CGTHBA
  • RMD11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-52131
Species: Hu
Applications: IHC, PEP-ELISA
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-24551
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB4169
Species: Hu
Applications: WB, IHC
H00093659-T01
Species: Hu
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-88447
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for NPRL3 Antibody (NBP1-88447)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-88447 Applications Species
Peng M, Yin N, Li MO. SZT2 dictates GATOR control of mTORC1 signalling. Nature. 2017 Feb 15 [PMID: 28199315]

Reviews for NPRL3 Antibody (NBP1-88447) (0)

There are no reviews for NPRL3 Antibody (NBP1-88447). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NPRL3 Antibody (NBP1-88447) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPRL3 Products

Bioinformatics Tool for NPRL3 Antibody (NBP1-88447)

Discover related pathways, diseases and genes to NPRL3 Antibody (NBP1-88447). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPRL3 Antibody (NBP1-88447)

Discover more about diseases related to NPRL3 Antibody (NBP1-88447).
 

Pathways for NPRL3 Antibody (NBP1-88447)

View related products by pathway.

PTMs for NPRL3 Antibody (NBP1-88447)

Learn more about PTMs related to NPRL3 Antibody (NBP1-88447).

Blogs on NPRL3

There are no specific blogs for NPRL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPRL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPRL3