NPM1 Antibody

Images

 
Western Blot: NPM1 Antibody [NBP1-90047] - Analysis in human cell line K562.
Immunocytochemistry/ Immunofluorescence: NPM1 Antibody [NBP1-90047] - Staining of human cell line A-431 shows localization to nucleus & nucleoli.
Immunohistochemistry-Paraffin: NPM1 Antibody [NBP1-90047] - Staining of human colon shows strong nuclear positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: NPM1 Antibody [NBP1-90047] - Staining of human cell line U-2 OS shows positivity in nucleus & nucleoli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NPM1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NPM1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
NPM1 Protein (NBP1-90047PEP)
Publications
Read Publications using
NBP1-90047 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%). Human reactivity reported in scientific literature (PMID: 21738817).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NPM1 Antibody

  • B23
  • MGC104254
  • NPM1
  • NPMnucleophosmin/nucleoplasmin family, member 1
  • Nucleolar phosphoprotein B23
  • Nucleolar protein NO38
  • nucleophosmin (nucleolar phosphoprotein B23, numatrin)
  • Nucleophosmin
  • Numatrin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF4210
Species: Hu
Applications: WB, IHC
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
MAB4648
Species: Hu, Mu, Rt
Applications: WB, ICC
AF7250
Species: Hu
Applications: IHC
NB110-57586
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, IHC, IHC-P
NB100-56161
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB300-576
Species: Hu, Mu, Rt, Ch, GP, Pm, Rb, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP2-46157
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-47804
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB600-248
Species: Hu
Applications: WB, IP
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-90047
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NPM1 Antibody (NBP1-90047)(3)

Reviews for NPM1 Antibody (NBP1-90047) (0)

There are no reviews for NPM1 Antibody (NBP1-90047). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NPM1 Antibody (NBP1-90047) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NPM1 Products

Bioinformatics Tool for NPM1 Antibody (NBP1-90047)

Discover related pathways, diseases and genes to NPM1 Antibody (NBP1-90047). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NPM1 Antibody (NBP1-90047)

Discover more about diseases related to NPM1 Antibody (NBP1-90047).
 

Pathways for NPM1 Antibody (NBP1-90047)

View related products by pathway.

PTMs for NPM1 Antibody (NBP1-90047)

Learn more about PTMs related to NPM1 Antibody (NBP1-90047).
 

Research Areas for NPM1 Antibody (NBP1-90047)

Find related products by research area.

Blogs on NPM1

There are no specific blogs for NPM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NPM1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NPM1
Entrez