NPM1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NPM1 Antibody [NBP1-90047] - Staining of human cell line A-431 shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NPM1 Antibody [NBP1-90047] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NPM1 Antibody [NBP1-90047] - Staining of human endometrium shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: NPM1 Antibody [NBP1-90047] - Staining of human cerebral cortex shows moderate to strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: NPM1 Antibody [NBP1-90047] - Staining of human cervix, uterine shows moderate to strong nuclear positivity in glandular cells.

Analysis in human cell line K562.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NPM1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NPM1 Antibody - BSA Free (NBP1-90047) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NPM1 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NPM1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NPM1 Protein (NBP1-90047PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%). Human reactivity reported in scientific literature (PMID: 21738817).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NPM1 Antibody - BSA Free

• B23
• MGC104254
• NPM1
• NPMnucleophosmin/nucleoplasmin family, member 1
• Nucleolar phosphoprotein B23
• Nucleolar protein NO38
• nucleophosmin (nucleolar phosphoprotein B23, numatrin)
• Nucleophosmin
• Numatrin

Background

Nucleophosmin (NPM) is a multi-functional protein that is involved in many cellular activities including cell growth, proliferation and transformation. It is frequently overexpressed in solid tumors, and has recently been found to be mutated and aberrantly localized in the cytoplasm of leukaemic blasts in patients with acute myeloid leukemia (AML).

NMP antibodies are useful tools as tumor markers in cancer research.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NPM1 Antibody (NBP1-90047)(3)

Publications using NBP1-90047

• O'Dwyer D, Ralton LD, O'Shea A, Murray GI. The Proteomics of Colorectal Cancer: Identification of a Protein Signature Associated with Prognosis. PLoS One 2011-01-01 [PMID: 22125622]
• Rower C, Ziems B, Radtke A et al. Toponostics of invasive ductal breast carcinoma: combination of spatial protein expression imaging and quantitative proteome signature analysis. Int J Clin Exp Pathol 2011-03-31 [PMID: 21738817] (IF/IHC, Human)
• Bolander A, Agnarsdottir M, Stromberg S et al. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics Proteomics 2008-11-01 [PMID: 19287070]

Bioinformatics

• Gene Symbol: NPM1