NOXO1 Antibody - BSA Free

Immunohistochemistry-Paraffin: NOXO1 Antibody [NBP2-49663] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NOXO1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LLETYSRRLLATAERVARSPTITGFFAPQPLDLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOXO1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NOXO1 Recombinant Protein Antigen (NBP2-49663PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NOXO1 Antibody - BSA Free

• MGC20258
• NADPH oxidase organizer 1
• Nox organizer 1
• Nox-organizing protein 1
• P41NOX
• P41NOXA
• P41NOXB
• P41NOXC
• regulatory protein P41NOX
• SH3 and PX domain-containing protein 5
• SH3PXD5NADPH oxidase regulatory protein
• SNX28

Background

NOXO1 (Nox organizing protein 1) and NOXA1 (Nox Activating protein 1) are homologs of p47phox and p67phox. p47phox functions in phagocytes as an essential organizing protein mediating the binding of other regulatory proteins during activation of the phagocyte oxidase, and its translocation to the membrane is triggered upon cell activation by hyperphosphorylation, which relieves autoinhibition of SH3 and PX domains. NOXO1 lacks an auto inhibitory region and phosphorylation sites that are present in p47phox. Co-transfection of Nox1, NOXO1 and NOXA1 reconstitutes ROS (reactive oxygen species) generation in HEK 293 cells in the absence of cell stimulation. NOXO1 binds to the phosphatidylinositol (PtdIns) lipids PtdIns 3,5-P2, PtdIns 5-P and PtdIns 4-P. Unlike p47phox, which is located in the cytosol of resting cells and translocates to the plasma membrane where gp91phox is located, NOXO1 co-localizes with Nox1 in the membranes of resting cells. This localization of NOXO1 is dictated by its PX domain, since this domain but not the remainder of the molecule localizes to membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NOXO1