Prohibitin 2 Antibody (8I10B1)

Western Blot: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Western blot analysis of extracts of various cell lines, using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunofluorescence analysis of U-2 OS cells using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunohistochemistry of paraffin-embedded human colon carcinoma using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunocytochemistry/Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunofluorescence analysis of NIH-3T3 cells using Prohibitin 2 (Prohibitin 2) Rabbit mAb (NBP3-16766) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Immunoprecipitation analysis of 300ug extracts of SKOV3 cells using 3ug Prohibitin 2 antibody (NBP3-16766). Western blot was performed from the immunoprecipitate using Prohibitin 2 antibody (NBP3-16766) at a dilition of 1:1000.

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Confocal imaging of NIH/3T3 cells using Prohibitin 2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [NBP3-16766] - Confocal imaging of U-2 OS cells using Prohibitin 2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [Prohibitin 2] - Confocal imaging of NIH/3T3 cells using Prohibitin 2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: Prohibitin 2 Antibody (8I10B1) [Prohibitin 2] - Confocal imaging of U-2 OS cells using Prohibitin 2 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: 8I10B1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Prohibitin 2 Antibody (8I10B1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Prohibitin 2 (Prohibitin 2) (Q99623). QMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAK
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PHB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:3000 - 1:6000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Prohibitin 2 Antibody (8I10B1)

• BAP
• Bap37
• BCAP37
• B-cell associated protein
• D-Prohibitin
• MGC117268
• p22
• PHB2
• PNAS-141
• Prohibitin 2
• prohibitin-2
• REA
• REAB-cell receptor-associated protein BAP37
• Repressor of estrogen receptor activity

Background

REA, or repressor of estrogen receptor activity, (also known as BAP37, or B-cell receptor-associated protein) is a 37 kD erythrocyte band 7 integral membrane protein that contains an SPFH domain. It is located in the inner mitochondrial membrane that selectively potentiates the inhibitory effectiveness of antiestrogen-occupied ER. REA plays a possible role in cell aging and acts as a mitochondrial protein chaperone. This protein has been shown to interact with the estrogen receptor, prohibitin, and IgM.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PHB2