NOXO1 Antibody

Images

 
Immunohistochemistry: NOXO1 Antibody [NBP2-49663] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOXO1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LLETYSRRLLATAERVARSPTITGFFAPQPLDLE
Specificity
Specificity of human NOXO1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOXO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NOXO1 Recombinant Protein Antigen (NBP2-49663PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOXO1 Antibody

  • MGC20258
  • NADPH oxidase organizer 1
  • Nox organizer 1
  • Nox-organizing protein 1
  • P41NOX
  • P41NOXA
  • P41NOXB
  • P41NOXC
  • regulatory protein P41NOX
  • SH3 and PX domain-containing protein 5
  • SH3PXD5NADPH oxidase regulatory protein
  • SNX28

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-41012
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-790
Species: Hu, Mu, Po, Ba
Applications: WB, Flow, IHC, IHC-P, IP, PEP-ELISA, IF
NBP2-13677
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NB100-1343
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-84254
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-98673
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82542
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-80467
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83139
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P

Publications for NOXO1 Antibody (NBP2-49663) (0)

There are no publications for NOXO1 Antibody (NBP2-49663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOXO1 Antibody (NBP2-49663) (0)

There are no reviews for NOXO1 Antibody (NBP2-49663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NOXO1 Antibody (NBP2-49663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NOXO1 Products

Bioinformatics Tool for NOXO1 Antibody (NBP2-49663)

Discover related pathways, diseases and genes to NOXO1 Antibody (NBP2-49663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOXO1 Antibody (NBP2-49663)

Discover more about diseases related to NOXO1 Antibody (NBP2-49663).
 

Pathways for NOXO1 Antibody (NBP2-49663)

View related products by pathway.

PTMs for NOXO1 Antibody (NBP2-49663)

Learn more about PTMs related to NOXO1 Antibody (NBP2-49663).
 

Research Areas for NOXO1 Antibody (NBP2-49663)

Find related products by research area.

Blogs on NOXO1

There are no specific blogs for NOXO1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOXO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOXO1