Nox4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Nox4 Antibody [NBP2-54670] - Staining of human cell line HUVEC TERT2 shows localization to nucleus.
Immunohistochemistry-Paraffin: Nox4 Antibody [NBP2-54670] - Staining of human pancreas shows moderate positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: Nox4 Antibody [NBP2-54670] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Nox4 Antibody [NBP2-54670] - Staining in human kidney and pancreas tissues.. Corresponding NOX4 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Nox4 Antibody [NBP2-54670] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in proximal tubules.
Immunohistochemistry-Paraffin: Nox4 Antibody [NBP2-54670] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Nox4 Antibody Summary

Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids: ISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANFPQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYI
Specificity
Specificity of human Nox4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOX4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Nox4 Recombinant Protein Antigen (NBP2-54670PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Nox4 Antibody

  • EC 1.6.3
  • Kidney oxidase-1
  • Kidney superoxide-producing NADPH oxidase
  • KOX
  • KOX-1
  • KOX-1Renal NAD(P)H-oxidase
  • NADPH oxidase 4
  • Nox4
  • RENOX
  • RENOXEC 1.6.3.-

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13754
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC

Publications for Nox4 Antibody (NBP2-54670) (0)

There are no publications for Nox4 Antibody (NBP2-54670).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nox4 Antibody (NBP2-54670) (0)

There are no reviews for Nox4 Antibody (NBP2-54670). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Nox4 Antibody (NBP2-54670) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Nox4 Antibody (NBP2-54670)

Discover related pathways, diseases and genes to Nox4 Antibody (NBP2-54670). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nox4 Antibody (NBP2-54670)

Discover more about diseases related to Nox4 Antibody (NBP2-54670).
 

Pathways for Nox4 Antibody (NBP2-54670)

View related products by pathway.

PTMs for Nox4 Antibody (NBP2-54670)

Learn more about PTMs related to Nox4 Antibody (NBP2-54670).
 

Research Areas for Nox4 Antibody (NBP2-54670)

Find related products by research area.

Blogs on Nox4.

NOX4 Antibodies: Don't NOX them until you've tried them
NOX4 is an NADPH oxidase that generates superoxide within the cell. It is primarily found in vascular cells, fibroblasts, and osteoclasts, with abundant expression in the kidney. Unlike its family members NOX1 and NOX2, NOX4 is constitutively active,...  Read full blog post.

NOX4 Antibodies in Diabetic Nephropathy Research
Diabetic nephropathy (DN) is one of the leading complications resulting from chronic diabetes. It manifests as progressive renal failure caused by mesangial cell hyperplasia and fibrosis, and is one of the leading causes of terminal kidney disease (1)...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nox4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOX4
Entrez