Notch-3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Notch-3 Antibody [NBP2-48812] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & actin filaments. Antibody staining is shown in ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Notch-3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOTCH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Notch-3 Recombinant Protein Antigen (NBP2-48812PEP)

Reactivity Notes

Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Notch-3 Antibody

  • CADASIL
  • CASILneurogenic locus notch homolog protein 3
  • Notch (Drosophila) homolog 3
  • notch 3Notch homolog 3 (Drosophila)
  • Notch homolog 3
  • Notch3
  • Notch-3

Background

The NOTCH3 gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-78486
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF1190
Species: Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB100-93551
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-51843
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-47791
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
H00008209-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
1277-JG
Species: Hu
Applications: BA
236-EG
Species: Hu
Applications: BA
1726-JG
Species: Hu
Applications: BA
AF1389
Species: Mu
Applications: ICC, IHC, WB
NBP2-16818
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, WB
MAB1144
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NBP3-03905
Species: Hu, Mu, Rt
Applications: WB
NBP2-41305
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
MAB2916
Species: Hu
Applications: IP, WB
NBP2-48812
Species: Hu
Applications: ICC/IF

Publications for Notch-3 Antibody (NBP2-48812) (0)

There are no publications for Notch-3 Antibody (NBP2-48812).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Notch-3 Antibody (NBP2-48812) (0)

There are no reviews for Notch-3 Antibody (NBP2-48812). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Notch-3 Antibody (NBP2-48812) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Notch-3 Products

Bioinformatics Tool for Notch-3 Antibody (NBP2-48812)

Discover related pathways, diseases and genes to Notch-3 Antibody (NBP2-48812). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Notch-3 Antibody (NBP2-48812)

Discover more about diseases related to Notch-3 Antibody (NBP2-48812).
 

Pathways for Notch-3 Antibody (NBP2-48812)

View related products by pathway.

PTMs for Notch-3 Antibody (NBP2-48812)

Learn more about PTMs related to Notch-3 Antibody (NBP2-48812).
 

Research Areas for Notch-3 Antibody (NBP2-48812)

Find related products by research area.

Blogs on Notch-3

There are no specific blogs for Notch-3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Notch-3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOTCH3