Norrin/NDP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Norrin/NDP Antibody [NBP1-59305] - Staining of vascular BM whole mounts with antibodies to proteins detected in the proteome analysis. A norrin-specific staining is shown to be ...read more
Western Blot: NDP/Norrin Antibody [NBP1-59305] - Fetal Liver tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: NDP/Norrin Antibody [NBP1-59305] - Human Brain, cortex tissue at an antibody concentration of 5ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Norrin/NDP Antibody Summary

Immunogen
Synthetic peptides corresponding to NDP(Norrie disease (pseudoglioma)) The peptide sequence was selected from the middle region of NDP. Peptide sequence DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 2-5 ug/ml
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against NDP and was validated on Western blot. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID : 29284024).
Publications
Read Publication using
NBP1-59305 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Norrin/NDP Antibody

  • EVR2
  • exudative vitreoretinopathy 2 (X-linked)
  • FEVR
  • ND
  • NDP
  • Norrie disease (pseudoglioma)
  • Norrie disease protein
  • Norrin
  • X-linked exudative vitreoretinopathy 2 protein

Background

NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). NDP may be involved in a pathway that regulates neural cell differentiation and proliferation. NDP is the genetic locus identified as harboring mutations that result in Norrie disease. Norrie disease is a rare genetic disorder characterized by bilateral congenital blindness that is caused by a vascularized mass behind each lens due to a maldeveloped retina (pseudoglioma). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 AL034370.1 53727-53820 c 95-1761 X65882.1 1-1667 1762-1935 BE139596.1 1-174 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00004830-M02
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF194
Species: Mu
Applications: IHC, WB
H00004831-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF6646
Species: Hu
Applications: WB
210-TA/CF
Species: Hu
Applications: BA
NBP3-13106
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-858
Species: Gp, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, PEP-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB600-41532
Species: Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP3-05546
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-59305
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Norrin/NDP Antibody (NBP1-59305)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Norrin/NDP Antibody (NBP1-59305) (0)

There are no reviews for Norrin/NDP Antibody (NBP1-59305). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Norrin/NDP Antibody (NBP1-59305) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Norrin/NDP Products

Bioinformatics Tool for Norrin/NDP Antibody (NBP1-59305)

Discover related pathways, diseases and genes to Norrin/NDP Antibody (NBP1-59305). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Norrin/NDP Antibody (NBP1-59305)

Discover more about diseases related to Norrin/NDP Antibody (NBP1-59305).
 

Pathways for Norrin/NDP Antibody (NBP1-59305)

View related products by pathway.

PTMs for Norrin/NDP Antibody (NBP1-59305)

Learn more about PTMs related to Norrin/NDP Antibody (NBP1-59305).
 

Research Areas for Norrin/NDP Antibody (NBP1-59305)

Find related products by research area.

Blogs on Norrin/NDP

There are no specific blogs for Norrin/NDP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Norrin/NDP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDP
Uniprot