Norrin/NDP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Norrin/NDP Antibody [NBP1-59305] - Staining of vascular BM whole mounts with antibodies to proteins detected in the proteome analysis. A norrin-specific staining is shown to be generic for the entire vascular BM whole mounts (H), the signal, however, being less prominent in vascular aneurisms (arrow in H). Staining of vascular BM whole mounts from non-diabetic eyes showed a clearly weaker staining for norrin, when compared to vascular whole mounts from non-diabetic donors. Bar: 25um. Image collected and cropped by CiteAb from the following publication (journals.plos.org/plosone/article?id=10.1371/journal.pone.0189857), licensed under a CC-BY license.

Western Blot: NDP/Norrin Antibody [NBP1-59305] - Fetal Liver tissue lysate at a concentration of 1ug/ml.

Immunohistochemistry-Paraffin: NDP/Norrin Antibody [NBP1-59305] - Human Brain, cortex tissue at an antibody concentration of 5ug/ml.

Immunocytochemistry/ Immunofluorescence: Norrin/NDP Antibody [NBP1-59305] - Staining of vascular BM whole mounts with antibodies to proteins detected in the proteome analysis.A generic staining of the vascular BMs was given by an antibody to the 7S domain of collagen IV alpha 3 (A, C, E, F, G). Prominent staining for microvascular aneurisms was detected by staining with antibodies to C9 (B, C), Fibronectin (FN, E), ApoE (F) & PRELP (G). The same treatment of vascular BM whole mounts from non-diabetic eyes did not show staining for these proteins (D). A norrin-specific staining is shown to be generic for the entire vascular BM whole mounts (H), the signal, however, being less prominent in vascular aneurisms (arrow in H). Staining of vascular BM whole mounts from non-diabetic eyes showed a clearly weaker staining for norrin, when compared to vascular whole mounts from non-diabetic donors. Bar: 25um. Image collected & cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0189857), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Norrin/NDP Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to NDP(Norrie disease (pseudoglioma)) The peptide sequence was selected from the middle region of NDP. Peptide sequence DPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTV. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NDP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 2-5 ug/ml
  • Western Blot 1.0 ug/ml
• Application Notes: Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID : 29284024).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Norrin/NDP Antibody - BSA Free

• EVR2
• exudative vitreoretinopathy 2 (X-linked)
• FEVR
• ND
• NDP
• Norrie disease (pseudoglioma)
• Norrie disease protein
• Norrin
• X-linked exudative vitreoretinopathy 2 protein

Background

NDP activates the canonical Wnt signaling pathway through FZD4 and LRP5 coreceptor. NDP plays a central role in retinal vascularization by acting as a ligand for FZD4 that signals via stabilizing beta-catenin (CTNNB1) and activating LEF/TCF-mediated transcriptional programs. NDP acts in concert with TSPAN12 to activate FZD4 independently of the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). NDP may be involved in a pathway that regulates neural cell differentiation and proliferation. NDP is the genetic locus identified as harboring mutations that result in Norrie disease. Norrie disease is a rare genetic disorder characterized by bilateral congenital blindness that is caused by a vascularized mass behind each lens due to a maldeveloped retina (pseudoglioma). Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-94 AL034370.1 53727-53820 c 95-1761 X65882.1 1-1667 1762-1935 BE139596.1 1-174 c

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Norrin/NDP Antibody (NBP1-59305)(1)

Publication using NBP1-59305

• Halfter W, Moes S, Asgeirsson DO et al. Diabetes-related changes in the protein composition and the biomechanical properties of human retinal vascular basement membranes. PLoS ONE 2017-12-28 [PMID: 29284024] (ICC/IF, Human)

Bioinformatics

• Gene Symbol: NDP
• Uniprot:
  • Q00604()