![Western Blot: NOP58 Antibody [NBP1-81681] - Analysis using Anti-NOP58 antibody NBP1-81681 (A) shows similar pattern to independent antibody NBP1-81680 (B).](http://images.novusbio.com/fullsize/NOP58-Antibody-Western-Blot-NBP1-81681-img0011.jpg "Western Blot: NOP58 Antibody [NBP1-81681] - Analysis using Anti-NOP58 antibody NBP1-81681 (A) shows similar pattern to independent antibody NBP1-81680 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit NOP58 Antibody - BSA Free (NBP1-81681) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-NOP58 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLKHFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIHSPVVNELMRGIRSQMDGL |
| Marker | Nucleolar Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NOP58 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-81681 | Applications | Species |
|---|---|---|
| Wang X, Li ZT, Yan Y et al. LARP7-Mediated U6 snRNA Modification Ensures Splicing Fidelity and Spermatogenesis in Mice Mol. Cell 2020-01-20 [PMID: 32017896] |
Secondary Antibodies |
Isotype Controls |
Research Areas for NOP58 Antibody (NBP1-81681)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NOP58 |
![Western Blot: NOP58 Antibody [NBP1-81681] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/NOP58-Antibody-Western-Blot-NBP1-81681-img0010.jpg "Western Blot: NOP58 Antibody [NBP1-81681] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: NOP58 Antibody [NBP1-81681] - Staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NOP58-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81681-img0009.jpg "Immunocytochemistry/Immunofluorescence: NOP58 Antibody [NBP1-81681] - Staining of human cell line A-431 shows localization to nucleus & nucleoli fibrillar center. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81681] - Staining of human esophagus shows strong nuclear positivity, seen as distinctly stained nucleoli, in squamous epithelial cells.](http://images.novusbio.com/fullsize/NOP58-Antibody-Immunohistochemistry-Paraffin-NBP1-81681-img0007.jpg "Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81681] - Staining of human esophagus shows strong nuclear positivity, seen as distinctly stained nucleoli, in squamous epithelial cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")