We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NONO Antibody - BSA Free

Images

 
Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with ...read more
Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] - Immunofluorescence analysis of NIH-3T3 cells using NONO Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat ...read more
Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Rat lung using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M ...read more
Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed ...read more
Western Blot: NONO Antibody [NBP3-38132] - Western blot analysis of various lysates using NONO Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 ...read more
Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed ...read more
Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] - Immunofluorescence analysis of C6 cells using NONO Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit ...read more
Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Rat liver using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M ...read more
Immunohistochemistry: NONO Antibody [NBP3-38132] - Immunohistochemistry analysis of paraffin-embedded Mouse brain using NONO Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with ...read more
Immunocytochemistry/ Immunofluorescence: NONO Antibody [NBP3-38132] - Immunofluorescence analysis of U-2 OS cells using NONO Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

NONO Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human NONO (NP_001138881.1).

Sequence:
EGLTIDLKNFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NONO
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for NONO Antibody - BSA Free

  • NMT5552 kDa subunit
  • non-POU domain containing, octamer-binding
  • NRB54non-POU-domain-containing, octamer-binding
  • p54(nrb)

Background

Non-POU-domain-containing octamer binding protein (NONO) is a member of the DBHS (drosophila behavior, human splicing) domain-containing family and is an RNA- and DNA- binding protein. NONO and other DBHS domain-containing proteins are multifunctional and are reported to be involved in transcriptional regulation, mRNA processing, and DNA non-homologous end joining (NHEJ). NONO functions as a coregulator of the androgen receptor (AR) and also regulates cAMP transcriptional activity by interacting with gene promoter elements. NONO is also involved in pre-mRNA splicing through an interaction with U5 snRNA and can stimulate DNA nonhomologous end joining (NHEJ) through the interaction with ku70/G22p and ku80/XRCC5 dimers. Alternate names for NONO include 54 kDa nuclear RNA- and DNA-binding protein, p54 (nrb), 55 kDa nuclear protein, NMT55, DNA-binding p52/p100 complex, NRB54, P54, and P54NRB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20329
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB100-74360
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB200-191
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83801
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-92392
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB

Publications for NONO Antibody (NBP3-38132) (0)

There are no publications for NONO Antibody (NBP3-38132).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NONO Antibody (NBP3-38132) (0)

There are no reviews for NONO Antibody (NBP3-38132). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NONO Antibody (NBP3-38132) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NONO Products

Research Areas for NONO Antibody (NBP3-38132)

Find related products by research area.

Blogs on NONO

There are no specific blogs for NONO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NONO Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol NONO