SREC-II/SCARF2 Antibody

Western Blot: SREC-II/SCARF2 Antibody [NBP1-83140] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Immunocytochemistry/Immunofluorescence: SREC-II/SCARF2 Antibody [NBP1-83140] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Western Blot: SREC-II/SCARF2 Antibody [NBP1-83140] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-553

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SREC-II/SCARF2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCARF2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SREC-II/SCARF2 Protein (NBP1-83140PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SREC-II/SCARF2 Antibody

• HUMZD58C02
• SCARF2
• scavenger receptor class F, member 2
• Scavenger receptor expressed by endothelial cells 2 protein
• SREC2NSR1
• SRECII
• SREC-II
• SREC-IIscavenger receptor class F member 2
• SRECRP-1
• SREPCR

Background

The protein encoded by the SCARF2 gene is similar to SCARF1/SREC-I, a scavenger receptor protein that mediates the bindingand degradation of acetylated low density lipoprotein (Ac-LDL). This protein has only little activity of internalizingmodified low density lipoproteins (LDL), but it can interact with SCARF1 through its extracellular domain. Theassociation of this protein with SCARF1 is suppressed by the presence of scavenger ligands. Alternatively splicedtranscript variants encoding distinct isoforms have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCARF2