Novus Biologicals products are now on bio-techne.com

SREC-II/SCARF2 Antibody

Images

 
Western Blot: SREC-II/SCARF2 Antibody [NBP1-83140] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SREC-II/SCARF2 Antibody [NBP1-83140] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Western Blot: SREC-II/SCARF2 Antibody [NBP1-83140] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-553
Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SREC-II/SCARF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCARF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SREC-II/SCARF2 Protein (NBP1-83140PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SREC-II/SCARF2 Antibody

  • HUMZD58C02
  • SCARF2
  • scavenger receptor class F, member 2
  • Scavenger receptor expressed by endothelial cells 2 protein
  • SREC2NSR1
  • SRECII
  • SREC-II
  • SREC-IIscavenger receptor class F member 2
  • SRECRP-1
  • SREPCR

Background

The protein encoded by the SCARF2 gene is similar to SCARF1/SREC-I, a scavenger receptor protein that mediates the bindingand degradation of acetylated low density lipoprotein (Ac-LDL). This protein has only little activity of internalizingmodified low density lipoproteins (LDL), but it can interact with SCARF1 through its extracellular domain. Theassociation of this protein with SCARF1 is suppressed by the presence of scavenger ligands. Alternatively splicedtranscript variants encoding distinct isoforms have been reported. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-241
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
AF2409
Species: Hu
Applications: Block, CyTOF-ready, Flow, WB
NBP2-31742
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12461
Species: Hu, Rt
Applications: ELISA, IP, WB
NBP2-93867
Species: Hu, Mu, Rt
Applications: WB
NBP2-33582
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
MAB4356
Species: Hu, Mu, Rt
Applications: WB
NBP2-01578
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, KD, WB
NBP2-86827
Species: Hu
Applications: WB
NBP2-49242
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-567
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
H00004675-D01P
Species: Hu
Applications: ICC/IF, WB
NBP2-38905
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-33610
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-83140
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for SREC-II/SCARF2 Antibody (NBP1-83140) (0)

There are no publications for SREC-II/SCARF2 Antibody (NBP1-83140).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SREC-II/SCARF2 Antibody (NBP1-83140) (0)

There are no reviews for SREC-II/SCARF2 Antibody (NBP1-83140). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SREC-II/SCARF2 Antibody (NBP1-83140) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SREC-II/SCARF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARF2