SREC-II/SCARF2 Antibody

Images

 
Western Blot: SREC-II/SCARF2 Antibody [NBP1-83140] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: SREC-II/SCARF2 Antibody [NBP1-83140] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: SREC-II/SCARF2 Antibody [NBP1-83140] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.
Western Blot: SREC-II/SCARF2 Antibody [NBP1-83140] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-553

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SREC-II/SCARF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:HHDLDNTLNCSFLEPPSGLEQPSPSWSSRASFSSFDTTDEGPVYCVPHEEAPAESRDPEVPTVP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCARF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SREC-II/SCARF2 Protein (NBP1-83140PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SREC-II/SCARF2 Antibody

  • HUMZD58C02
  • SCARF2
  • scavenger receptor class F, member 2
  • Scavenger receptor expressed by endothelial cells 2 protein
  • SREC2NSR1
  • SRECII
  • SREC-II
  • SREC-IIscavenger receptor class F member 2
  • SRECRP-1
  • SREPCR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM
AF2409
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NBP2-31742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84423
Species: Hu
Applications: IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Ce, Ch, Dr, Pl, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBL1-16438
Species: Hu
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
H00004675-D01P
Species: Hu
Applications: WB, ICC/IF
NBP2-38905
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83140
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SREC-II/SCARF2 Antibody (NBP1-83140) (0)

There are no publications for SREC-II/SCARF2 Antibody (NBP1-83140).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SREC-II/SCARF2 Antibody (NBP1-83140) (0)

There are no reviews for SREC-II/SCARF2 Antibody (NBP1-83140). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SREC-II/SCARF2 Antibody (NBP1-83140) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SREC-II/SCARF2 Products

Bioinformatics Tool for SREC-II/SCARF2 Antibody (NBP1-83140)

Discover related pathways, diseases and genes to SREC-II/SCARF2 Antibody (NBP1-83140). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SREC-II/SCARF2 Antibody (NBP1-83140)

Discover more about diseases related to SREC-II/SCARF2 Antibody (NBP1-83140).
 

Pathways for SREC-II/SCARF2 Antibody (NBP1-83140)

View related products by pathway.

PTMs for SREC-II/SCARF2 Antibody (NBP1-83140)

Learn more about PTMs related to SREC-II/SCARF2 Antibody (NBP1-83140).

Blogs on SREC-II/SCARF2

There are no specific blogs for SREC-II/SCARF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SREC-II/SCARF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARF2
Entrez