NOL4 Antibody (2A10)

Images

 
Immunocytochemistry/ Immunofluorescence: NOL4 Antibody (2A10) [H00008715-M01] - Analysis of monoclonal antibody to NOL4 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: NOL4 Antibody (2A10) [H00008715-M01] - Analysis of monoclonal antibody to NOL4 on formalin-fixed paraffin-embedded human testis. Antibody concentration 3 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
2A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NOL4 Antibody (2A10) Summary

Immunogen
NOL4 (NP_003778 425 a.a. - 524 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PGSQDVLYINGNGTYSYHSYRGLGGGLLNLNDASSSGPTDLSMKRQLATSSGSSSSSNSRPQLSPTEINAVRQLVAGYRESAAFLLRSADELENLILQQN
Specificity
NOL4 - nucleolar protein 4
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NOL4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been used for IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NOL4 Antibody (2A10)

  • CT125
  • HRIHFB2255
  • NOLPcancer/testis antigen 125
  • nucleolar localized protein
  • nucleolar protein 4
  • Nucleolar-localized protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB5277
Species: Hu
Applications: WB, IHC
NBP1-84929
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-182
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-89707
Species: Hu
Applications: IHC, IHC-P
H00001846-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-14016
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4160
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-14114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2045
Species: Hu
Applications: WB, IHC, ICC
NBP1-85269
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88875
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
PP-A8620A-00
Species: Hu, Mu
Applications: WB, IHC, IP, DirELISA
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi

Publications for NOL4 Antibody (H00008715-M01) (0)

There are no publications for NOL4 Antibody (H00008715-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOL4 Antibody (H00008715-M01) (0)

There are no reviews for NOL4 Antibody (H00008715-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOL4 Antibody (H00008715-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOL4 Products

Bioinformatics Tool for NOL4 Antibody (H00008715-M01)

Discover related pathways, diseases and genes to NOL4 Antibody (H00008715-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOL4 Antibody (H00008715-M01)

Discover more about diseases related to NOL4 Antibody (H00008715-M01).
 

Pathways for NOL4 Antibody (H00008715-M01)

View related products by pathway.

PTMs for NOL4 Antibody (H00008715-M01)

Learn more about PTMs related to NOL4 Antibody (H00008715-M01).

Blogs on NOL4

There are no specific blogs for NOL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOL4 Antibody (2A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol NOL4
Entrez
OMIM
Uniprot