Recombinant Human LHFPL4 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human LHFPL4 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 247 of Human LHFPL4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
LHFPL4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
53.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LHFPL4 GST (N-Term) Protein

  • LHFP-like protein 4
  • lipoma HMGIC fusion partner-like 4 protein
  • lipoma HMGIC fusion partner-like 4
  • MGC133162

Background

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30662
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00008715-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-1574
Species: Hu, Mu
Applications: ICC, IHC, IHC-P, IP, KD, WB
NBP2-57678
Species: Hu
Applications: ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P

Publications for LHFPL4 Recombinant Protein (H00375323-P01) (0)

There are no publications for LHFPL4 Recombinant Protein (H00375323-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHFPL4 Recombinant Protein (H00375323-P01) (0)

There are no reviews for LHFPL4 Recombinant Protein (H00375323-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHFPL4 Recombinant Protein (H00375323-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LHFPL4 Products

Array H00375323-P01

Bioinformatics Tool for LHFPL4 Recombinant Protein (H00375323-P01)

Discover related pathways, diseases and genes to LHFPL4 Recombinant Protein (H00375323-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHFPL4 Recombinant Protein (H00375323-P01)

Discover more about diseases related to LHFPL4 Recombinant Protein (H00375323-P01).
 

Pathways for LHFPL4 Recombinant Protein (H00375323-P01)

View related products by pathway.

PTMs for LHFPL4 Recombinant Protein (H00375323-P01)

Learn more about PTMs related to LHFPL4 Recombinant Protein (H00375323-P01).

Blogs on LHFPL4

There are no specific blogs for LHFPL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SKIV2L2 Antibody
NB100-1574

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LHFPL4 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LHFPL4