Recombinant Human LHFPL4 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human LHFPL4 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 247 of Human LHFPL4 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFGLFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCNTATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILAIIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCPVAHSQGP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
LHFPL4

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human LHFPL4 Protein

  • LHFP-like protein 4
  • lipoma HMGIC fusion partner-like 4 protein
  • lipoma HMGIC fusion partner-like 4
  • MGC133162

Background

This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NBP1-57244
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57678
Species: Hu
Applications: ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P

Publications for LHFPL4 Recombinant Protein (H00375323-P01) (0)

There are no publications for LHFPL4 Recombinant Protein (H00375323-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LHFPL4 Recombinant Protein (H00375323-P01) (0)

There are no reviews for LHFPL4 Recombinant Protein (H00375323-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for LHFPL4 Recombinant Protein (H00375323-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LHFPL4 Products

LHFPL4 H00375323-P01

Bioinformatics Tool for LHFPL4 Recombinant Protein (H00375323-P01)

Discover related pathways, diseases and genes to LHFPL4 Recombinant Protein (H00375323-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LHFPL4 Recombinant Protein (H00375323-P01)

Discover more about diseases related to LHFPL4 Recombinant Protein (H00375323-P01).
 

Pathways for LHFPL4 Recombinant Protein (H00375323-P01)

View related products by pathway.

PTMs for LHFPL4 Recombinant Protein (H00375323-P01)

Learn more about PTMs related to LHFPL4 Recombinant Protein (H00375323-P01).

Blogs on LHFPL4

There are no specific blogs for LHFPL4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SKIV2L2 Antibody
NB100-1574
LHFPL4 Antibody
NBP1-86225

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human LHFPL4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol LHFPL4