Nodal Antibody (5C3) - Azide and BSA Free

Western Blot: Nodal Antibody (5C3) [H00004838-M03] - Analysis of NODAL expression in Raw 264.7 (Cat # L024V1).

Immunocytochemistry/Immunofluorescence: Nodal Antibody (5C3) [H00004838-M03] - Analysis of monoclonal antibody to NODAL on HeLa cell. Antibody concentration 10 ug/ml

Immunohistochemistry-Paraffin: Nodal Antibody (5C3) [H00004838-M03] - Analysis of monoclonal antibody to NODAL on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml

Western Blot: Nodal Antibody (5C3) [H00004838-M03] - Analysis of NODAL expression in HeLa (Cat # L013V1).

Western Blot: Nodal Antibody (5C3) [H00004838-M03] - Analysis of NODAL expression in PC-12 (Cat # L012V1).

ELISA: Nodal Antibody (5C3) [H00004838-M03] - Detection limit for recombinant GST tagged NODAL is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 5C3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Nodal Antibody (5C3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: NODAL (NP_060525, 275 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGC
• Localization: Secreted
• Specificity: NODAL - nodal homolog (mouse)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NODAL
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nodal Antibody (5C3) - Azide and BSA Free

• BMP-16
• MGC138230
• nodal homolog (mouse)
• nodal homolog
• Nodal
• nodal, mouse, homolog

Background

The protein encoded by this gene is a member of the TGF-beta superfamily. Studies of the mouse counterpart suggested that this gene may be essential for mesoderm formation and subsequent organization of axial structures in early embryonic development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nodal Antibody (H00004838-M03)(2)

Publications using H00004838-M03

• Lawrence MG, Margaryan NV, Loessner D et Al. Reactivation of embryonic nodal signaling is associated with tumor progression and promotes the growth of prostate cancer cells Prostate 2012-08-01 [PMID: 21656830]
• Lawrence MG, Margaryan NV, Loessner D et al. Reactivation of embryonic nodal signaling is associated with tumor progression and promotes the growth of prostate cancer cells. Prostate. 2011-01-12 [PMID: 21229563]

Bioinformatics

• Gene Symbol: NODAL
• Entrez:
  • 4838(Human)
• OMIM:
  • 601265(Human)
• Uniprot:
  • NP_060525(Human)