Description | A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NOD2. Source: E. coli Amino Acid Sequence: PGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIP Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source | E. coli |
Protein/Peptide Type | Recombinant Protein Antigen |
Gene | NOD2 |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Dilutions |
|
Application Notes | This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58617. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW | 27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS and 1M Urea, pH 7.4. |
Preservative | No Preservative |
Purity | >80% by SDS-PAGE and Coomassie blue staining |
Research Areas for NOD2 Recombinant Protein Antigen (NBP2-58617PEP)Find related products by research area.
|
Read full blog post. |
Transferrin and the blood brain barrier Transferrin, an iron binding protein that facilitates iron uptake in cells, is an integral part of a mechanism that may introduce antibody therapies to the central nervous system. Currently, the brain’s ability to take in antibody therapies i... Read full blog post. |
MHC Class I and the Herpes Simplex Virus MHC molecules (also known as major histocompatibility complex molecules) assist in the presentation of antigens to T cells in order to eradicate foreign pathogens. These molecules are highly polymorphic, meaning that they exist in multiple varian... Read full blog post. |
Cluster of Differentiation 3 (CD3) (OKT3 clone) as a Marker of Immune Response Efficiency Our immune system is a powerful defense mechanism against infection, however different variables can cause our immune response to work for or against us. CD3 (cluster of differentiation 3) is one component of our immune signal response that is co... Read full blog post. |
NOD2 - inflammatory signaling and NFkB activation Nucleotide-binding oligomerization domain-containing protein 2 (NOD2) is an intracellular pattern recognition receptor (PRR) that plays an important role in recognizing bacterial pathogens and initiating an immune response. As a PRR, NOD2 recogniz... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | NOD2 |