NOD2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: NOD2 Antibody [NBP2-58617] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus. Antibody staining is shown in green.

Product Details

Summary
Product Discontinued
View other related NOD2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-58617
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NOD2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PGNSPMARLLPTMCIQASEGKDSSVAALLQKAEPHNLQITAAFLAGLLSREHWGLLAECQTSEKALLRRQACARWCLARSLRKHFHSIP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOD2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for NOD2 Antibody

  • BLAU
  • CARD15caspase recruitment domain protein 15
  • caspase recruitment domain family, member 15
  • Caspase recruitment domain-containing protein 15
  • CDACUG
  • CLR16.3
  • IBD1NLR family, CARD domain containing 2
  • Inflammatory bowel disease protein 1
  • NLRC2
  • NOD-like receptor C2
  • nucleotide-binding oligomerization domain 2
  • nucleotide-binding oligomerization domain containing 2
  • nucleotide-binding oligomerization domain, leucine rich repeat and CARD domaincontaining 2
  • nucleotide-binding oligomerization domain-containing protein 2
  • PSORAS1NOD2B

Background

NOD2 (nucleotide-binding oligomerization domain containing 2) is a member of the apoptosis regulating protein family that includes caspase recruitment-domains, as well as Apaf-1 and NOD1. It contains two N-terminal CARDs, a nucleotide binding domain (NBD), and multiple C-terminal leucine-rich repeats (LRRs). NOD2 is expressed in monocytes (whereas NOD1 is expressed in multiple tissues). NOD2 plays a role in regulating NF-kappaB. It also acts as an intracellular receptor for bacterial lipopolysaccharides and contributes to inflammatory bowel disease (IBD) and Crohn's disease.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1106
Species: Hu
Applications: IP, WB
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
7268-CT
Species: Hu
Applications: BA
202-IL
Species: Hu
Applications: BA
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF4117
Species: Rt
Applications: IHC, WB
NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
M6000B
Species: Mu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
AF2009
Species: Hu
Applications: ICC, IHC
6507-IL/CF
Species: Hu
Applications: BA
NBP2-67605
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, ISH, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB2772
Species: Hu, Pm
Applications: Block, CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC
NBP1-83790
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for NOD2 Antibody (NBP2-58617) (0)

There are no publications for NOD2 Antibody (NBP2-58617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOD2 Antibody (NBP2-58617) (0)

There are no reviews for NOD2 Antibody (NBP2-58617). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for NOD2 Antibody (NBP2-58617). (Showing 1 - 1 of 1 FAQ).

  1. Can you suggest the best NOD2 antibody for detection of endogenous NOD2 in human fibroblasts?
    • For detecting endogenous NOD2 in human samples, I would recommend NB100-524. This antibody has been validated for use in WB, IHC-Paraffin and IP.

Secondary Antibodies

 

Isotype Controls

Additional NOD2 Products

Research Areas for NOD2 Antibody (NBP2-58617)

Find related products by research area.

Blogs on NOD2.


  Read full blog post.

Transferrin and the blood brain barrier
Transferrin, an iron binding protein that facilitates iron uptake in cells, is an integral part of a mechanism that may introduce antibody therapies to the central nervous system. Currently, the brain’s ability to take in antibody therapies i...  Read full blog post.

MHC Class I and the Herpes Simplex Virus
MHC molecules (also known as major histocompatibility complex molecules) assist in the presentation of antigens to T cells in order to eradicate foreign pathogens.  These molecules are highly polymorphic, meaning that they exist in multiple varian...  Read full blog post.

Cluster of Differentiation 3 (CD3) (OKT3 clone) as a Marker of Immune Response Efficiency
Our immune system is a powerful defense mechanism against infection, however different variables can cause our immune response to work for or against us.  CD3 (cluster of differentiation 3) is one component of our immune signal response that is co...  Read full blog post.

NOD2 - inflammatory signaling and NFkB activation
Nucleotide-binding oligomerization domain-containing protein 2 (NOD2) is an intracellular pattern recognition receptor (PRR) that plays an important role in recognizing bacterial pathogens and initiating an immune response. As a PRR, NOD2 recogniz...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOD2